DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15812 and psq

Sequence 1:NP_523897.2 Gene:CG15812 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001014520.2 Gene:psq FlyBaseID:FBgn0263102 Length:1123 Species:Drosophila melanogaster

Alignment Length:612 Identity:117/613 (19%)
Similarity:210/613 (34%) Gaps:161/613 (26%)


  Fly     4 LKWMGHSSTIMDIQRSLRNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRNLLVDVPRGQEATI 68
            |:|..:.:|:..:.:.||.|....:|.|:...| .::||..|||.||...:.||::.| .:..||
  Fly    12 LRWNNYQNTMTSVFQQLREDLSFVDVTLSCEHG-SLKAHKVVLSACSTYFQKLLLENP-CKHPTI 74

  Fly    69 MLP-DIRGDLLECMLSFIYMGETSLPSASLPEFLEAINLLGIKSAI-----SFECNPSASPPSVD 127
            :|| ||....|:.::.|:|.||..:..:.|...|.....|.||...     :.:.|.:|:.....
  Fly    75 ILPADIIFTDLKTIIDFVYRGEIDVTESELQGLLRTAEQLKIKGLCETAENADDLNDAATATITV 139

  Fly   128 VENHSLAV----ESAKSITGLQIAEAELLDDEEEPHPMVSVPATTLAGSQHQPS--HSSRSLEYI 186
            .||...||    .:|..:.|   |.:..|:.:::.|..   .....|..|||..  |:.:..:  
  Fly   140 SENIQQAVVGNIVNAAIVPG---APSPSLEQQQQHHQQ---QQQQQAQEQHQQQQVHAQQQQQ-- 196

  Fly   187 DVYEPPKITYSIEHMDGSSSGN-----QFILTENTGT----------------FTITQSASSLSK 230
               :..:|..::....|.|||:     |.:.:..:|:                ...|...|.|.:
  Fly   197 ---QQQQINAALLTQHGVSSGSVSLSGQLLSSSASGSSGSLAGGQQASQTPSGLQPTPRKSRLKR 258

  Fly   231 IEADETGTSGAEVDLGDDDVDA--DLAEDSEEHESQMIDEEFAQADPLMELE------------A 281
            .::.:..:.|.....|.....:  ...:.:..|..|.|..:....:.::.|:            :
  Fly   259 SKSPDLSSGGGAGSSGGSSSGSTQQQPQPAHHHHPQTILIQGQNPNSIVSLQQTADGNYIPVSGS 323

  Fly   282 GTEMDDDD---------------------DVHDQLVDEEIDDKPRKLGGGKTRIRRPIS------ 319
            |.:.|.:|                     ..|:...|.|.:.||.|:...:..:..|.|      
  Fly   324 GDDSDAEDHEHEHNHGHGHGHGGHTHGHGHSHEHSHDHEHEHKPNKICKTEHSVASPASNSSSAS 388

  Fly   320 --AKAVKRLSDCKPTRIQQFAALKREVKDDIN-----------------DALDL--------AAD 357
              |..|..::......:.|. .:.|:.||..|                 ..||.        |..
  Fly   389 NNAAGVSGVTSTGQAIVTQI-VVARDGKDTKNMTSLGMGMNGGLLGVPMGFLDFTPEPPAPSATP 452

  Fly   358 AVIIE--GLSLQKAADRFDISKTVLWRRVRTNPAYMRNNRERPSLQEAYERLKNGHSLKSISSEL 420
            ..:.|  .||...:.|..|:|.|       |.|..:.|:     |.:...||.            
  Fly   453 VTVTEHVDLSCNPSTDTRDLSNT-------TEPLDIDNH-----LAQQIHRLD------------ 493

  Fly   421 QIPMSTLHRHKVRLSAQGRLPNFVSCRKRDNTPKDELRDKLAKAVHACLNEGMSQ--NHAANLFE 483
            |.||.::..|.....:...|...:.        .:.:..|...|.|..|::...|  :|.|:   
  Fly   494 QSPMHSISHHHTGDESNSNLVQHIK--------SEVIEAKHLAAQHHALSQAQQQHAHHQAH--- 547

  Fly   484 IPKSTLWRHLQRRTTSQNKKVKKELKA 510
                   :..|:....|:::.::.|.|
  Fly   548 -------QQHQQHQQQQHQQQQQHLHA 567

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 32/94 (34%)
BTB 35..118 CDD:197585 27/89 (30%)
HTH_psq 348..392 CDD:283007 13/71 (18%)
HTH_psq 458..501 CDD:283007 9/45 (20%)
psqNP_001014520.2 BTB 25..125 CDD:279045 32/102 (31%)
BTB 36..126 CDD:197585 29/92 (32%)
HTH_psq 717..>747 CDD:283007
HTH_psq 767..804 CDD:283007
HTH_psq 821..866 CDD:283007
HTH_psq 873..916 CDD:283007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23110
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.