DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-30 and Ndufs3

DIOPT Version :8

Sequence 1:NP_647775.1 Gene:ND-30 / 38378 FlyBaseID:FBgn0266582 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001099959.1 Gene:Ndufs3 / 295923 RGDID:1309406 Length:264 Species:Rattus norvegicus

Alignment Length:266 Identity:163/267 (61%)
Similarity:191/267 (72%) Gaps:7/267 (3%)


  Fly     1 MAALIRNLGARAAVAALSAKHVVPAAGSTALRMASTTPVEPKKADK-PTVRQPDAVARSHLSDFG 64
            ||:....:..|..:.|.|   |...||..::.:......|...||| ||||....|....||.||
  Rat     1 MASAAARVWCRGLLGAAS---VARGAGRPSVLLQQRVRRESAAADKRPTVRPSSDVTHKRLSAFG 62

  Fly    65 RYVAECLPKYVQKVQLTAGDELEVLIAPEGVVPVLQFLKDHHQAQFTNLVDIAGVDVPCRKNRFE 129
            .||||.||||||:||:|..||||:.|.|:||:|.:.|||||..|||.:|.|:..||||.|:||||
  Rat    63 EYVAEILPKYVQQVQVTCFDELEICIHPDGVIPTITFLKDHTNAQFKSLADLTAVDVPTRQNRFE 127

  Fly   130 VVYNLLSLRYNSRIRVKTYTDELTPLDSACEVHKAANWYEREIWDMYGVFFANHPDLRRILTDYG 194
            :||||||||:|||||||||.||||.:||...||.||||||||:|||:||||.|||||||||||||
  Rat   128 IVYNLLSLRFNSRIRVKTYADELTAIDSIVSVHIAANWYEREVWDMFGVFFFNHPDLRRILTDYG 192

  Fly   195 FEGHPQRRDFPLSGYVELRYDDEKKRVVCEPLELAQEFRKFDLSAPWEQFPNFRNANPPAEVVPP 259
            |||||.|:||||:||||||||||.||||.||:|||||||||||::|||.||.:|.   |.|.:..
  Rat   193 FEGHPFRKDFPLTGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYRQ---PPEHLKL 254

  Fly   260 QAPAKK 265
            :|..||
  Rat   255 EAGDKK 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ND-30NP_647775.1 PRK06074 60..242 CDD:235691 137/182 (75%)
Ndufs3NP_001099959.1 PRK06074 57..240 CDD:235691 137/183 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C258886139
eggNOG 1 0.900 E1_COG0852
Hieranoid 1 1.000
Homologene 1 1.000 H3346
Inparanoid 1 1.050 319 1.000 Inparanoid score I2418
OMA 1 1.010
OrthoDB 1 1.010 D1276923at2759
OrthoFinder 1 1.000 FOG0006586
OrthoInspector 1 1.000 T1088887
orthoMCL 1 0.900 OOG5_128842
Panther 1 1.100 LDO PTHR10884
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.