DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BtbVII and Nacc1

Sequence 1:NP_647774.2 Gene:BtbVII FlyBaseID:FBgn0263108 Length:907 Species:Drosophila melanogaster
Sequence 2:NP_080064.3 Gene:Nacc1 MGIID:1914080 Length:514 Species:Mus musculus

Alignment Length:662 Identity:127/663 (19%)
Similarity:208/663 (31%) Gaps:208/663 (31%)


  Fly    15 PNFISVCSSLLH----NGTLVDVTLAAEGRQLQAHKIVLSACSSYFQALFTTNPCQHPIVIL-KD 74
            |||.:.....|:    .|...||::..:|...:||:.||:|.||||:.||  |..:..:|.| ..
Mouse    10 PNFGNSILECLNEQRLQGLYCDVSVVVKGHAFKAHRAVLAASSSYFRDLF--NSSRSAVVELPAA 72

  Fly    75 VQYDDLKTMVDFMYYGEVNVSQEQLPHILKTAEMLKIKGLAEMPTDPANLTKSDSKSSTDGTEMV 139
            ||....:.::.|.|.|.::::......::.||..|:|:.:.|                 .|||..
Mouse    73 VQPQSFQQILTFCYTGRLSMNMGDQFLLIYTAGFLQIQEIME-----------------KGTEFF 120

  Fly   140 GGAGVGTGAGNSAGSLGAGSGSSVGDSLWSSSEAQQFQQQQQQQAQQQAQQQHHHHQQQQQLQQQ 204
                           |...|.|.....|                                     
Mouse   121 ---------------LKVSSPSCDSQGL------------------------------------- 133

  Fly   205 QQQAQQQQQQQQHHHHHHQQQQSGQAQA--AQTHHHQMRRTPSPL-----------SAGTSPATR 256
                            |.::..|.:.|:  |||.......||.||           |...:|.. 
Mouse   134 ----------------HPEEAPSSEPQSPVAQTLGWPACSTPLPLVSRVKTEQELDSVQCTPMA- 181

  Fly   257 RKRLRKSSNNGSGDRNNAEEQHNSSLDAGSGAGNAGLSLAQMNQMTFGAGGGLAGHSLHAAKLLK 321
             |||..||...:|               |||..|....:|:.:                      
Mouse   182 -KRLWDSSQKEAG---------------GSGGNNGSRKMAKFS---------------------- 208

  Fly   322 ESASAELEQQPQDSDLDDGHGHLHMQIKPEVDIGGVNQTMPLDISGGTTPSEHDAPNSQSSHSEP 386
             :....|.:.||...:......:.:     |.:||        ...|.:.||..:|.:.|:::..
Mouse   209 -TPDLALNRMPQPLSMATATAAVAV-----VAVGG--------CVSGPSMSERTSPGTSSAYTSD 259

  Fly   387 SPAHAPHPPHPPLGAASSSSGGSGSFER---------SFSIGGVGSVECDPDGTPSSPAVMGTKR 442
            ||:...:...     ....:|..|:.|:         .:|:..||......:..|..  |:...|
Mouse   260 SPSSYHNEED-----EEEDAGEEGTDEQYRQICNMYTMYSMLNVGQTAEKVEALPEQ--VVLESR 317

  Fly   443 NRVLTRQPRVKRDSDSISS--TNQISPDTAATTLD-FDPFNAAGATSATARDYSTTGSHHLHHQS 504
            :|:     ||::|..|:.:  .|||.........| .||.......:.| ..|.|.......|.|
Mouse   318 SRI-----RVRQDLASLPAELINQIGNRCHPKLYDEGDPSEKLELVTGT-NVYITRAQLMNCHVS 376

  Fly   505 AVHHHHHLL--TVPPRIERH--ASEPAPSLAPST--PHLLSVPSSTPYLIKQHSDPLLPRQSALH 563
            |...|..||  .:....:|:  |:.....:..||  |....:.|...:.:|.:.....|......
Mouse   377 AGTRHKVLLRRLLASFFDRNTLANSCGTGIRSSTNDPRRKPLDSRVLHAVKYYCQNFAPNFKESE 441

  Fly   564 MAGSGSGSSSAMATGSNPFA---------PLHRQYSHPLSGSN-ASYVTPAPLHHPHHISLPESI 618
            |    :..::.|.|.:....         |||.     :.|.| :|:::......|..:|:..|.
Mouse   442 M----NAIAADMCTNARRVVRKSWLPKTKPLHL-----VEGDNYSSFISDTCKIEPDMMSMEHSF 497

  Fly   619 YASGSPPPAGSS 630
            ..:.....||.|
Mouse   498 ETASHDGEAGPS 509

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BtbVIINP_647774.2 BTB 24..117 CDD:279045 29/98 (30%)
BTB 32..117 CDD:197585 27/86 (31%)
Nacc1NP_080064.3 BTB 20..122 CDD:306997 33/136 (24%)
BEN 382..460 CDD:214981 13/82 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5233
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.