DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BtbVII and lola

Sequence 1:NP_647774.2 Gene:BtbVII FlyBaseID:FBgn0263108 Length:907 Species:Drosophila melanogaster
Sequence 2:NP_788308.3 Gene:lola FlyBaseID:FBgn0283521 Length:970 Species:Drosophila melanogaster

Alignment Length:1029 Identity:234/1030 (23%)
Similarity:357/1030 (35%) Gaps:296/1030 (29%)


  Fly     4 QQFCLRWNNHQPNFISVCSSLLHNGTLVDVTLAAEGRQLQAHKIVLSACSSYFQALFTTNPCQHP 68
            |||||||||||...|||..:||.|.||||.||||||:.|:|||:||||||.||..|......:||
  Fly     5 QQFCLRWNNHQSTLISVFDTLLENETLVDCTLAAEGKFLKAHKVVLSACSPYFATLLQEQYDKHP 69

  Fly    69 IVILKDVQYDDLKTMVDFMYYGEVNVSQEQLPHILKTAEMLKIKGLAEMPTDPANLTKSDSKSST 133
            |.|||||:|.:|:.|:|:||.||||:||:||..:||.||.|:||||::..|......|.:|....
  Fly    70 IFILKDVKYQELRAMMDYMYRGEVNISQDQLAALLKAAESLQIKGLSDNRTGGGVAPKPESSGHH 134

  Fly   134 DGTEMVGG--------AGVGT-GAGNSAGSLGAGSGSSVGDSLWSSSEAQQFQQQQQQQAQQQAQ 189
            .|.::.|.        |.:.| ||.:::|.:   |||..|    |||.:::.::.:::..:..|.
  Fly   135 RGGKLSGAYTLEQTKRARLATGGAMDTSGDV---SGSREG----SSSPSRRRRKVRRRSMENDAH 192

  Fly   190 QQHHHHQQQ-----QQLQQQ-----------------------QQQAQQQQQQQQHHHHHHQQQ- 225
            ...:....|     |.:.||                       ..||...||||.....:..:: 
  Fly   193 DNSNSSVLQAAASNQSILQQTGAGLAVSALVTTQLSSGPAAGTSSQASSTQQQQPLTSTNVTKKT 257

  Fly   226 ---------------QSGQAQAAQTHHHQMRRTPSPLSAGTSPATRRKRLRKSSNNGS----GDR 271
                           .|..|...|.|.||.:      :..||.|...:.::..|..|:    || 
  Fly   258 ESAKLTSSTAAPASGASASAAVQQAHLHQQQ------AQTTSDAINTENVQAQSQGGAQGVQGD- 315

  Fly   272 NNAEEQHNSSLDAGSGAGNAGLSLAQMNQMTFGAGGGLAGHSLHAAKLLKESAS----------- 325
                   :..:|.||..|..       |..|.......:..::||..::|:.||           
  Fly   316 -------DEDIDEGSAVGGP-------NSATGPNPASASASAVHAGVVVKQLASVVDKSSSNHKH 366

  Fly   326 -----------AELEQQPQDSDLDDGHGHLHMQIKPEVDIGGVNQTM-PLDISGGTTPS------ 372
                       :|:..:|:....||.|.    :...::.:...:.|| .||.:.||:..      
  Fly   367 KIKDNSVSSVGSEMVIEPKAEYDDDAHD----ENVEDLTLDEEDMTMEELDQTAGTSQGGEGSSQ 427

  Fly   373 -----EHDAPNSQSSHSE----PSPAHAPHPPHPPLGAASSSSGGSGSFERSFSIGGVGSVEC-- 426
                 :||     .|..|    ...|....|..........:.|....||..         :|  
  Fly   428 TYATWQHD-----RSQDELGLMAQDAQQRDPQASKQDKGEQTEGAQDEFELD---------DCLL 478

  Fly   427 ---------DPDGTPSSPAVMGT------KRNRVLTRQ----------------PRVKRDSDSIS 460
                     :.||.......:|.      :.|:.:.:|                |.:....::.:
  Fly   479 ESNDIVITQNKDGFVLHVKKLGNITAAKLEENQAVAQQQGQAAVTVTGPAGQPTPTITELLNAAA 543

  Fly   461 STNQISPDTAATTLDFDP----------FNAAGATSATARDYSTTGSHHLHHQSAVHHHHHLL-- 513
            :::. .|....|||...|          .|......||    :|..:||.|..|.:.|.||::  
  Fly   544 ASHS-EPKPTLTTLTSTPIKLPSSECELINIKKIIPAT----TTIATHHPHTSSTIIHPHHIIQH 603

  Fly   514 -TVPPRIERHASEPAPSLAPSTPHLLSVP-SSTPYLIKQHS------DPLLPRQSALHMAGSGS- 569
             :..|..:.|..:      ..|.|:..|| :|..:..:||.      .|...:..::..|..|. 
  Fly   604 VSQEPHHQEHHQQ------HQTIHIEEVPQTSQQHHQQQHHHQLQTVQPTHTQVQSIITAHPGQT 662

  Fly   570 ----GSSSAMATGSNPFAPLHRQYSHPLSG---SNASYV-TPAPLHHPHH--------------- 611
                |..:.....|.|.|...|.....:.|   .|...| |..|:.|.||               
  Fly   663 INLVGLRNVQLADSKPIASRIRYSRGKIIGPTVQNLQIVETHEPIQHQHHELSDGTKYEISEIDL 727

  Fly   612 ---------------------ISLPESIYASGSPPPAGSSQYLVPTRVVACPVVSSETAATPTNA 655
                                 |.||:.........|:..::::..:        ..||..|....
  Fly   728 NNPNASAAIISDLVKYAEIDDIELPDGTKIGIGFAPSEITEHMQTS--------GGETHITTIEH 784

  Fly   656 SPGSSSTVSAAVSVVTSPNAGLQNSASRHPLSPTFSIGSDVAHERRSPHSPSISRSQVVERAGKN 720
            .|....||........:.:.......:.|..:...|......|:::..|     :...:|....:
  Fly   785 EPQELQTVHQHEQTQQTHHIHAGQLQTHHIQTVVQSSSGQQQHDQQQHH-----QHHSIELQDDD 844

  Fly   721 PAEAANGGGSRLRTSKSASGSITGTHLHPGQATMSSSFEHLPTLRVKNEELQRSVSSPQTQREII 785
            ..|                 :||...|  |....|.|:..|.|..:|.|    |...|......:
  Fly   845 GVE-----------------TITPEEL--GMHDSSKSYTILTTRPMKEE----SEHDPSGMTYEL 886

  Fly   786 TLENPRSSHCPVIRPGPALGCNFC-----W-NTIDGHGRI-LRRKTKYH-CPEC 831
            :|.:  ||..|...|.....|..|     | :|:..|..: ...|...| ||.|
  Fly   887 SLSD--SSLGPCDDPESRYVCRHCGKKYRWKSTLRRHENVECGGKEPCHPCPYC 938

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BtbVIINP_647774.2 BTB 24..117 CDD:279045 57/93 (61%)
BTB 32..117 CDD:197585 51/85 (60%)
lolaNP_788308.3 BTB 22..117 CDD:279045 57/95 (60%)
BTB 33..117 CDD:197585 51/84 (61%)
C2H2 Zn finger 905..925 CDD:275368 5/20 (25%)
C2H2 Zn finger 935..955 CDD:275368 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000318
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23110
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.