DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BtbVII and CG6118

Sequence 1:NP_647774.2 Gene:BtbVII FlyBaseID:FBgn0263108 Length:907 Species:Drosophila melanogaster
Sequence 2:NP_001097806.1 Gene:CG6118 FlyBaseID:FBgn0038339 Length:967 Species:Drosophila melanogaster

Alignment Length:594 Identity:140/595 (24%)
Similarity:217/595 (36%) Gaps:167/595 (28%)


  Fly     2 SVQQFCLRWNNHQPNFISVCSSLLHNGTLVDVTLAAEGRQLQAHKIVLSACSSYFQALFTTNPCQ 66
            ::.|:.|.|||...|......||..:..:||||:||.|:..:|||:|||.||.|||.:|..||..
  Fly   389 TIDQYLLSWNNFHGNMCRGFHSLQKDEKMVDVTIAAGGKIFKAHKLVLSVCSPYFQQIFLENPSS 453

  Fly    67 HPIVILKDVQYDDLKTMVDFMYYGEVNVSQEQLPHILKTAEMLKIKGL---AEMPTDPANLTKSD 128
            |||:::.||:...:..::||||.|:|||..|.||..||.||.:|||||   ..:.:|.::::   
  Fly   454 HPILLMADVEASHMAGLLDFMYSGQVNVKYEDLPVFLKVAEAMKIKGLHTEKNLDSDASDIS--- 515

  Fly   129 SKSSTDGTEM---VGGAGVGTGAGNSAGSLGAGSGSSVGDSLWSSSEAQQFQQQQQQQAQQQAQQ 190
            |...:||||.   .|...|...:|::||..||.|                               
  Fly   516 SPHESDGTECRYERGTHSVNITSGHAAGYGGAPS------------------------------- 549

  Fly   191 QHHHHQQQQQLQQQQQQAQQQQQQQQHHHHHHQQQQSGQAQAAQTHHHQMRRTPSPLSAG----- 250
                                             .|||..:.:.    :...|.|:|||:|     
  Fly   550 ---------------------------------SQQSSPSPSL----NGPNRCPTPLSSGGSGNP 577

  Fly   251 -------------TSPATRRKRLRKSSNNGSGDRNNAEEQHNSSLDAGSGAGNAGLSLAQMNQMT 302
                         |...|..|.|.:::||     ||:...:|.     .|..|..|:|.:.:..:
  Fly   578 NYAGFREHIKSKATLAETFMKNLNRNNNN-----NNSSNNYNH-----LGGSNGSLNLTEADSNS 632

  Fly   303 FG--------------------AGGGLAGH---SLHAAKLLKESASAELEQQP----QDSDLDDG 340
            |.                    |...:..|   .|...|.|||   .|.::.|    .|..|::.
  Fly   633 FAILQANSKKMLDSARKQHKYLAKRKILMHYNTELGGEKRLKE---MERDRYPSAEQHDDALNNN 694

  Fly   341 HGHLHMQIKPEVDIGGVNQTMPLDISGGT-----TPSEHDAPNSQSSHSEPSPAHAPHPPHPPLG 400
            |.|....|...:....|.||.|.......     ..|.|...||.::.::.|..:.        .
  Fly   695 HSHAQDNIMEPIITTIVPQTPPPSTHNNNFKIRLVESHHLTNNSNNNQNQSSNNNN--------S 751

  Fly   401 AASSSSGGSGSFERSFSI------GGVGSVECDPDGTPSSPAVMGTKRNRVLTRQPRVKRDSDSI 459
            ::|..|....:.|.:.::      .|..:.|..|.....:|.:...||.......|     ::::
  Fly   752 SSSPQSNDCNNDEEALNLVQIPNANGSRNREATPTCATPTPDIQLIKREVKTELSP-----AENL 811

  Fly   460 SSTNQISPDTAATTLD---FDPFNAAGATSAT--ARDYSTTGSHHLHHQSAVHHHHHLLTVPPRI 519
            |:.|....:.|....|   .|..|.:|....|  ..:.|..|..:.:..:.....|.||:.   |
  Fly   812 SNNNGHDDEMAGAGFDRKYDDNNNNSGLDMETDSNNNNSKPGGDNNNGLALALGKHKLLSA---I 873

  Fly   520 ERHASEPAP 528
            .|:..:..|
  Fly   874 NRNIEQDHP 882

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BtbVIINP_647774.2 BTB 24..117 CDD:279045 47/96 (49%)
BTB 32..117 CDD:197585 45/88 (51%)
CG6118NP_001097806.1 Myb_DNA-bind_4 20..97 CDD:290549
BTB 408..508 CDD:279045 48/100 (48%)
BTB 419..510 CDD:197585 45/91 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000318
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23110
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.