DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BtbVII and bab1

Sequence 1:NP_647774.2 Gene:BtbVII FlyBaseID:FBgn0263108 Length:907 Species:Drosophila melanogaster
Sequence 2:NP_728565.1 Gene:bab1 FlyBaseID:FBgn0004870 Length:977 Species:Drosophila melanogaster

Alignment Length:972 Identity:228/973 (23%)
Similarity:322/973 (33%) Gaps:378/973 (39%)


  Fly     2 SVQQFCLRWNNHQPNFISVCSSLLHNGTLVDVTLAAEGRQLQAHKIVLSACSSYFQALFTTNPCQ 66
            |.|||||||||:|.|..::...||.|...||||||.:||.::|||:||||||.|||.|....|||
  Fly    98 SSQQFCLRWNNYQTNLTTIFDQLLQNECFVDVTLACDGRSMKAHKMVLSACSPYFQTLLAETPCQ 162

  Fly    67 HPIVILKDVQYDDLKTMVDFMYYGEVNVSQEQLPHILKTAEMLKIKGLAE--------------- 116
            |||||::||.:.|||.:|:|||.||:||||:|:..:|:.|||||::|||:               
  Fly   163 HPIVIMRDVNWSDLKAIVEFMYRGEINVSQDQIGPLLRIAEMLKVRGLADVTHMEAATAAAAAAS 227

  Fly   117 ---MPTDPANLTKSDSKSSTDGTE-------------MVGGAGVGTGAGNSA----GSLGAGSGS 161
               ||:.|...|      ||..||             |.....:.|...:.|    ..|....|.
  Fly   228 SERMPSSPKEST------STSRTEHDREREAEELLAFMQPEKKLRTSDWDPAELRLSPLERQQGR 286

  Fly   162 SVGDSLWSSSE-----------------AQQFQQQQQQQAQQQ---------------------- 187
            :|....|.|::                 |::.:.:|:::.:|:                      
  Fly   287 NVRKRRWPSADTIFNPPAPPSPLSSLIAAERMELEQKERERQRDCSLMTPPPKPPMSSGSTVGAT 351

  Fly   188 ---------------------AQQQHHHHQQQQQLQQQQQQAQQQQQQQQHHHHH-----HQQQQ 226
                                 ..:....|.|..|.||.|||.|.......|.|||     |..|.
  Fly   352 RRLETAIHALDMPSPAATPGPLSRSSRPHSQSPQQQQAQQQGQLPLPLPLHPHHHASPAPHPSQT 416

  Fly   227 SGQAQAAQTHHHQMRRTPSPLS-AGTS-----PATRRKRLRKSSNNGSGDRNNAEEQ------HN 279
            :|.|      ||       |.| ||.|     ||......|:.|..|.|.  :||.:      |:
  Fly   417 AGSA------HH-------PASPAGDSRFPLGPAAAMAAARELSGLGPGP--SAEPRLPPPPPHH 466

  Fly   280 SSLDAGSGAGNAGLSLAQMNQMTFGAGG-GLAGHSLHA---------AKLLKESASAELEQ---- 330
               ..|.|.|..|:...       |||| |..|.|..|         |::::|...|::.:    
  Fly   467 ---HGGGGVGGGGVGGG-------GAGGVGSGGGSSLADDLEIKPGIAEMIREEERAKMMENSHA 521

  Fly   331 -----------------------------------------------QPQD------SDLDDG-- 340
                                                           :|:.      |.|.:|  
  Fly   522 WMGATGSTLAADSYQYQLQSMWQKCWNTNQNLMHHMRFRERGPLKSWRPETMAEAIFSVLKEGLS 586

  Fly   341 ------------------HGHLHMQIKPEVDIGGVN-----QTMPLDISGGTTPSEH-------- 374
                              ...:|..:.|.:| ||.:     :..|..|..|..|.||        
  Fly   587 LSQAARKYDIPYPTFVLYANRVHNMLGPSID-GGPDLRPKGRGRPQRILLGIWPDEHIKGVIKTV 650

  Fly   375 ---DAPN----SQSSHSEPSPAHAPHPPHPPLGAASSSSGGSGSFERSFSIGGVGSVECDPDGTP 432
               |..:    |.::|..|...|:|..|...|  ..|..|.||:.     .|...|:.| |:|:.
  Fly   651 VFRDTKDIKDESLAAHMPPYGRHSPAFPLQDL--PLSYPGASGAL-----AGAPSSMAC-PNGSG 707

  Fly   433 SSPAVMGTKRNRVLTRQPRVKRDSDSISSTNQISPDTAATTLD------------------FD-- 477
            ....|                    .::....:|.:|||....                  |:  
  Fly   708 PQTGV--------------------GVAGEQHMSQETAAAVAAVAHNIRQQMQMAAVPPGLFNLP 752

  Fly   478 ------------PFNAAGATSATARDYSTTGSHH---------------------LHH---QSAV 506
                        |..|.|..|.:....|.:|..|                     |||   |.|.
  Fly   753 PHPGVGGGVGNVPGAAGGRASISPALSSGSGPRHAPSPCGPAGLLPNLPPSMAVALHHQQQQQAA 817

  Fly   507 HHHHHLLTVPPRIERHASEPAPSLAPSTPHLLSVPSSTPYLIKQHSDPLLPRQSALHMAG----- 566
            |||...|               .|.....||           ..|......:|...|..|     
  Fly   818 HHHMQQL---------------HLQQQQAHL-----------HHHQQQQQQQQQQHHQGGHQVAH 856

  Fly   567 -SGSGSSSAMATGSNPFAPLH--RQYSHPLSGSNASYVTPAPLHHP-HHISLPESIYASGSPPPA 627
             ||.|:||:.:..|:.....|  :..|.||...     ||. ||.| ..:.|..:.|.....|..
  Fly   857 KSGFGASSSSSASSSSMGQHHAPKAKSSPLRSE-----TPR-LHSPLGDLGLDMASYKREFSPSR 915

  Fly   628 GSSQYLVPTRVVACPVVSSETAATPTNASPGSSSTVSAAVSVVTSPNAGLQNSASRHPLSPT 689
            ..::.|  ..:|...|.||.::|....|.|..|:..::|.:...:|::.........|::.|
  Fly   916 LFAEDL--AELVGASVSSSSSSAAAATAPPERSAGAASAATGADAPSSSSSGGIKVEPITTT 975

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BtbVIINP_647774.2 BTB 24..117 CDD:279045 57/111 (51%)
BTB 32..117 CDD:197585 53/103 (51%)
bab1NP_728565.1 BTB 117..216 CDD:279045 57/99 (58%)
BTB 128..213 CDD:197585 53/85 (62%)
HTH_psq 569..614 CDD:283007 5/45 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000318
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23110
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.