DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BtbVII and psq

Sequence 1:NP_647774.2 Gene:BtbVII FlyBaseID:FBgn0263108 Length:907 Species:Drosophila melanogaster
Sequence 2:NP_001014520.2 Gene:psq FlyBaseID:FBgn0263102 Length:1123 Species:Drosophila melanogaster

Alignment Length:1226 Identity:273/1227 (22%)
Similarity:422/1227 (34%) Gaps:449/1227 (37%)


  Fly     4 QQFCLRWNNHQPNFISVCSSLLHNGTLVDVTLAAEGRQLQAHKIVLSACSSYFQALFTTNPCQHP 68
            |.|.|||||:|....||...|..:.:.|||||:.|...|:|||:||||||:|||.|...|||:||
  Fly     8 QYFSLRWNNYQNTMTSVFQQLREDLSFVDVTLSCEHGSLKAHKVVLSACSTYFQKLLLENPCKHP 72

  Fly    69 IVIL-KDVQYDDLKTMVDFMYYGEVNVSQEQLPHILKTAEMLKIKGLAEMPTDPANLTKSDSKSS 132
            .:|| .|:.:.||||::||:|.||::|::.:|..:|:|||.||||||.|...:..:|  :|:.::
  Fly    73 TIILPADIIFTDLKTIIDFVYRGEIDVTESELQGLLRTAEQLKIKGLCETAENADDL--NDAATA 135

  Fly   133 T-DGTEMVGGAGVGTGAGNSAGSLGAGSGSSVGDSLWSSSEAQQFQQQQQQQAQQQAQQQHHHHQ 196
            | ..:|.:..|.|| ...|:|...||.|.|           .:|.||..|||.|||||:||    
  Fly   136 TITVSENIQQAVVG-NIVNAAIVPGAPSPS-----------LEQQQQHHQQQQQQQAQEQH---- 184

  Fly   197 QQQQLQQQQQQAQQQQQQ----QQHHHHHHQQQQSGQ--------AQAAQTHHHQMRRTPSPLSA 249
            ||||:..||||.||||..    .||.........|||        :..:.....|..:|||    
  Fly   185 QQQQVHAQQQQQQQQQINAALLTQHGVSSGSVSLSGQLLSSSASGSSGSLAGGQQASQTPS---- 245

  Fly   250 GTSPATRRKRLRKSSNNGSGDRNNAEEQHNSSLDAGSGAGNAGLSLAQMNQMTFGAGGGLA---- 310
            |..|..|:.||::|.              :..|.:|.|||::|           |:..|..    
  Fly   246 GLQPTPRKSRLKRSK--------------SPDLSSGGGAGSSG-----------GSSSGSTQQQP 285

  Fly   311 --GHSLHAAKLL----KESASAELEQ-----------QPQDSDLDD-------GHGHLHMQIKPE 351
              .|..|...:|    ..::...|:|           ...|||.:|       ||||.|      
  Fly   286 QPAHHHHPQTILIQGQNPNSIVSLQQTADGNYIPVSGSGDDSDAEDHEHEHNHGHGHGH------ 344

  Fly   352 VDIGGVNQTMPLDISGGTT-----------PSEHD-APNS--QSSHSEPSPAHAPHPPHPPLGAA 402
                           ||.|           ..||: .||.  ::.||..|||....      .|:
  Fly   345 ---------------GGHTHGHGHSHEHSHDHEHEHKPNKICKTEHSVASPASNSS------SAS 388

  Fly   403 SSSSGGSGSFE---------------------RSFSIGGVGSVECDP----DGTPSSPAVMGTKR 442
            ::::|.||...                     .|..:|..|.:...|    |.||..||...|. 
  Fly   389 NNAAGVSGVTSTGQAIVTQIVVARDGKDTKNMTSLGMGMNGGLLGVPMGFLDFTPEPPAPSATP- 452

  Fly   443 NRVLTRQPRVKRDSDSISSTNQISPDTAAT-----------TLDFDPFNA--------------- 481
               :|....|....:..:.|..:|..|...           .||..|.::               
  Fly   453 ---VTVTEHVDLSCNPSTDTRDLSNTTEPLDIDNHLAQQIHRLDQSPMHSISHHHTGDESNSNLV 514

  Fly   482 ---------AGATSATARDYSTTGSHHLHHQSAVHHHHH-------------------------- 511
                     |...:|.....|.....|.|||:...|..|                          
  Fly   515 QHIKSEVIEAKHLAAQHHALSQAQQQHAHHQAHQQHQQHQQQQHQQQQQHLHAQQLLAQSQLQQQ 579

  Fly   512 --------------------------------------------LLTVPPRIERHASEPAPSLAP 532
                                                        ::.:.|...:|  ||...:.|
  Fly   580 QQQQQQQQQHHQQQQQQAAAAAAAAGVHGQHGGHVTHADIGGATVMEIDPSQIKH--EPGMIITP 642

  Fly   533 STPHLLS-----------------VPSSTPYLIKQHSDPLLPRQSAL---------HMAGSGSGS 571
            ...:::|                 :.:.:|:..|:.....|.:|..|         ..||.|.|.
  Fly   643 EIVNMMSSGHMDMYNSDTSEDSMMIANGSPHDQKEPHYTNLDQQHGLGGSVCGPGPGGAGGGGGM 707

  Fly   572 SSAMATGSNPFA--PLHRQYSHPLSGSNASYVTPAP----------LHHPH-------------- 610
            |....:||...|  .|..| :..|:.::|.|..|:.          :..|.              
  Fly   708 SGGAGSGSGEKALDALKNQ-NMSLTKASAIYGIPSTTLWQRAHRMGIETPKKEGGTKSWNEDALQ 771

  Fly   611 ---------HISLPESIYASGSPPPAGSSQYLVPTRV---VACPVVSSETAATPTNASPGSSSTV 663
                     .||..::..|.|.|   .|:.|.:..|.   :|.|..::.|..||.:        :
  Fly   772 NALEALRSGQISANKASKAFGIP---SSTLYKIARREGIRLAAPFNAAPTTWTPED--------L 825

  Fly   664 SAAVSVVTSPNAGLQNSASRHPLSPTFSI-------GSDVAHERRSPHSP--------------- 706
            ..|:..:.:.|..:|.:::...: ||.::       |.:::....:|.|.               
  Fly   826 ERALEAIRAGNTSVQKASAEFGI-PTGTLYGRCKREGIELSRSNPTPWSEDAMNEALNSVRVGQM 889

  Fly   707 SISRSQVVE-----------RAGKNPAEAANGGGSRLRTSKSASGSI------------------ 742
            ||:::.:..           :.||....|...|.:.|.||.:.:|||                  
  Fly   890 SINQAAIHYNLPYSSLYGRFKRGKYDVVANTSGVALLNTSGNTTGSIEIIEHSQENSQQFPYSPS 954

  Fly   743 ----TGTHLHPGQATMSSSFEHLPTLRVKNEELQRSVSSPQTQREIITLENPRSSHCPVIRPGPA 803
                |..| |......||:.:..||    .:.:|:.|...|.|::....::|...|.|.      
  Fly   955 PHPPTPQH-HSTPQHHSSAQQGPPT----PQHMQQHVVHMQQQQQQQQQQSPHPGHHPQ------ 1008

  Fly   804 LGCNFCWNTIDGHGRILRRKTKYHCPECQTNLCIVPCFQEYH---ER------------------ 847
               :...:.:....:::..:.:....:          ..::|   ||                  
  Fly  1009 ---HMQQDVVTSSSQVVHSQQQQQLQQ----------IYQHHGTPERSXESLHAATLMGSTGGGG 1060

  Fly   848 ---LNNEAAAASSGAAAGDNQLSS-STTGSGSSSSGKASPYVSSAGSSSSGAGAAR 899
               :...||:.|.|.||.....:| |...||.||:  ..|.|:::|||:...|.::
  Fly  1061 GGGVGGVAASTSDGTAASSTPFASISALVSGPSSA--PPPPVTASGSSAVSGGTSK 1114

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BtbVIINP_647774.2 BTB 24..117 CDD:279045 51/94 (54%)
BTB 32..117 CDD:197585 49/86 (57%)
psqNP_001014520.2 BTB 25..125 CDD:279045 51/100 (51%)
BTB 36..126 CDD:197585 49/90 (54%)
HTH_psq 717..>747 CDD:283007 7/31 (23%)
HTH_psq 767..804 CDD:283007 7/40 (18%)
HTH_psq 821..866 CDD:283007 8/54 (15%)
HTH_psq 873..916 CDD:283007 5/43 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5233
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000318
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23110
RoundUp 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.