DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BtbVII and chinmo

Sequence 1:NP_647774.2 Gene:BtbVII FlyBaseID:FBgn0263108 Length:907 Species:Drosophila melanogaster
Sequence 2:NP_001188680.1 Gene:chinmo FlyBaseID:FBgn0086758 Length:840 Species:Drosophila melanogaster

Alignment Length:841 Identity:185/842 (22%)
Similarity:281/842 (33%) Gaps:285/842 (34%)


  Fly     4 QQFCLRWNNHQPNFISVCSSLLHNGTLVDVTLAAEGRQLQAHKIVLSACSSYFQALFTTNP---- 64
            |||||:||:...|.....|:|..:..|.||.|:.:|...:|||::|:|||..|..||...|    
  Fly     5 QQFCLKWNSFSSNLAITFSNLFKSDLLADVILSCDGVVFKAHKLILAACSKKFADLFENTPTNGQ 69

  Fly    65 CQHPIVILKDVQYDDLKTMVDFMYYGEVNVSQEQLPHILKTAEMLKIKGLAE------------- 116
            |   ::||:....|::..:::|||.|||:||||.|...||:||.|::|||:.             
  Fly    70 C---VIILEATTPDNMAALLEFMYKGEVHVSQEALNSFLKSAESLQVKGLSTETGRLAAQQAQQH 131

  Fly   117 ----MPTDPANLTKSDSKSSTDGTEMV--GGAGVGTGAG----NSAGSLGAGSGSSVGDSLWSSS 171
                .|.|.....:|...|.:.|:..:  ||.|:|.|.|    ||...:|.|:|.|:..      
  Fly   132 MGDLSPLDSPTGRRSVRNSLSGGSSSIVPGGVGIGLGGGATGANSMSGMGIGNGLSLAG------ 190

  Fly   172 EAQQFQQQQQQQAQQQAQQQHHHHQQQQQLQQQQQQAQQQQQQQQHHHHHHQQQQSGQAQAAQTH 236
                                                               .....|.|.||...
  Fly   191 ---------------------------------------------------MAAGGGMAAAANAA 204

  Fly   237 HHQMRRTPSPLSAGTSPATR----RKRLRKSSNNGSGDRNNAEEQHNSSL------DAGSGAGNA 291
            ...:    |.|:|..:...|    ...:...|..|.|..::....:.|..      ..|||.||.
  Fly   205 ASSL----STLAASANIVDRCGSAGANIISGSAAGIGGSHSGGAGNGSGTVGIGGNGVGSGGGNN 265

  Fly   292 GLSLAQMNQMTFGAGGGLAGHSLHAAKLLKESASAELEQQPQDSDLDDGHGHLHMQ--IKPEVDI 354
            |       .::.|:|.|.|.|...:..:||:...:.:  .|..|....|.|:.|:.  .:|    
  Fly   266 G-------PISLGSGAGAAHHLGGSTGILKQECDSLM--HPGGSSSSSGMGYTHVPPIYRP---- 317

  Fly   355 GGVNQTMPLDISGGTTP-SEHDAPNS----QSSHSE-PSPAHAPHPPHPPLGAASS--------- 404
              :|...|...:...:| ||.:...|    .|..|| |||.:.| |.|.|..:|||         
  Fly   318 --INYEPPRKRAIVRSPYSEQEQRGSVLRDGSKSSECPSPINKP-PYHRPSSSASSTAPTEADTM 379

  Fly   405 ----SSGGSGSFERSFSIGGVGSVECDPDGTPSSPAVMGTKRNRVLTRQPRVKRDSDSISSTNQI 465
                :|..|..:|               :.:||:.|..|...:.:    .|:.:...:..|.|:.
  Fly   380 HSERASPQSSRYE---------------NHSPSTTAGNGNATSSL----ERIVKSERNNGSANEA 425

  Fly   466 SPDTAATTLDFDPFNAAGATSATARDYST-TGSHHLHHQSAVHHHHHLLTVPPRIERHASEPAPS 529
            :.|                 .....|.|| .|:..|.               .::|.....|.| 
  Fly   426 NDD-----------------DRELMDESTDNGAEDLR---------------VKLENLKYSPPP- 457

  Fly   530 LAPSTPHLLSVPSSTPYLIKQH--SDPLLPRQSALHMAGS-----------GSGSSSAMATGSNP 581
                 |...:..|:||..:.::  :|..|....|..:|.:           .:.:|...|.|.. 
  Fly   458 -----PPNSNTSSTTPNTLLENLKADGTLSSNLAASIAPADMLNVWNATKMNNKNSVNTADGKK- 516

  Fly   582 FAPLHRQYSHPLSGSNASYVT---------------PAPL-----------------HHPHHISL 614
               |...|...|.|    |.|               |.|.                 .|...|.|
  Fly   517 ---LKCLYCDRLYG----YETNLRAHIRQRHQGIRVPCPFCERTFTRNNTVRRHIAREHKQEIGL 574

  Fly   615 PESIYASGSPPPAGSSQYLVPTRVVACPVVSSETAATPTNASPGSSSTVSAAVSVVTSPNAGLQN 679
                       .||::  :.|..:.|....|:...|..:|.|| ..:..:||.|||.:.|    .
  Fly   575 -----------AAGAT--IAPAHLAAAAAASAAATAAASNHSP-XEAAATAAASVVMNAN----K 621

  Fly   680 SASRHPLSPTFSIGSDVAHERRSPHSPSISRSQVVE----------RAGKNPAEAANGGGS 730
            .|::.....|..:..:...:||.        :.|.|          .||....||.:|.||
  Fly   622 EAAKQRKRKTLKMALEKCMQRRD--------AMVAETTTGAGGDGAEAGGESGEAVDGAGS 674

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BtbVIINP_647774.2 BTB 24..117 CDD:279045 40/114 (35%)
BTB 32..117 CDD:197585 38/106 (36%)
chinmoNP_001188680.1 BTB 22..116 CDD:279045 40/97 (41%)
BTB 33..116 CDD:197585 37/86 (43%)
C2H2 Zn finger 519..540 CDD:275368 5/25 (20%)
C2H2 Zn finger 547..568 CDD:275368 1/21 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000318
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23110
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.