DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BtbVII and CG8924

Sequence 1:NP_647774.2 Gene:BtbVII FlyBaseID:FBgn0263108 Length:907 Species:Drosophila melanogaster
Sequence 2:NP_573091.1 Gene:CG8924 FlyBaseID:FBgn0030710 Length:514 Species:Drosophila melanogaster

Alignment Length:630 Identity:159/631 (25%)
Similarity:255/631 (40%) Gaps:182/631 (29%)


  Fly     2 SVQQFCLRWNNHQPNFISVCSSLLHNGTLVDVTLAAEGRQLQAHKIVLSACSSYFQALFTTNPCQ 66
            :.|:||:|||:|..:..:....||.....||||||.||:|:..|::||:|||:||:|:...:||:
  Fly     4 ATQEFCVRWNSHLGSIGAAFPQLLAGQRFVDVTLACEGQQVHCHRLVLAACSTYFEAILAEHPCK 68

  Fly    67 HPIVIL-KDVQYDDLKTMVDFMYYGEVNVSQEQLPHILKTAEMLKIKGL--AEMPTDPANLTKSD 128
            ||::|| ::::..:::.:|||||.|||||:|..|..:|:.||.|:|:||  :|.|.:...|.::.
  Fly    69 HPVIILPREIKLWEIQALVDFMYKGEVNVTQAGLGQLLRCAEQLQIRGLYGSEAPINYKKLQQAS 133

  Fly   129 SKSSTDGTEMVGGAGVGTGAG-----NSAGSLGAGSGSSVGDSLWSSSEAQQFQQQQQQQAQQQA 188
            .:::.|        ...|.|.     :||.:..|.:.|:...::.:||                |
  Fly   134 LEAAKD--------PAATTARSFKHVDSAETDDAATNSTTSTTMTTSS----------------A 174

  Fly   189 QQQHHHHQQQQQLQQQQQQAQQQQQQQQHHHHHHQQQQSGQAQAAQTHHHQMRRTPSPLSAGTSP 253
            .....:|||...|::|...|:|||||||      |||...:.|...::..|    ||        
  Fly   175 PPLPVNHQQPTVLKRQNPDARQQQQQQQ------QQQVQQRPQINGSNAQQ----PS-------- 221

  Fly   254 ATRRKRLRKSSNNGSGDRNNAEEQHNSSLDAGSGAGNAGLSLAQMNQMTFGAGGGLAGH-SLHAA 317
                   :.:|.|..|..:||..:.:|..:..:.....|......|.........:..| ||..|
  Fly   222 -------KATSTNVLGSHSNAPTEDDSGDEVPNNWNAYGEQFDDCNISAQAVDNKMNVHLSLQQA 279

  Fly   318 KLLKESASAELEQQPQ-DSDLDDGHGHLHMQIKPEVDIGGVNQTMPLDISGGTTPSEHDAPNSQS 381
            ::     ..:|:||.. ||:::|.|.::                           :.|| .|:.|
  Fly   280 RM-----QMQLQQQQYLDSNVEDDHNYV---------------------------AAHD-ENNDS 311

  Fly   382 SHSEPSPAHAPHPPHPPLGAASSSSGGSGSFERSFSIGGVGSVECDPDGTPSSPAVMGTKRNRV- 445
            |.:...|.                  |||.           |:..|.|...|:....|...:.: 
  Fly   312 SFATGVPC------------------GSGL-----------SLSLDTDLDTSANTSGGLSHSSID 347

  Fly   446 -LTRQPRVKRDSDSISSTNQ-ISPDTAATTLDFDPFNAAGATSATARDYST-----------TGS 497
             .|...||:|...|::...: :|......|:.    |......:|.|.|..           .|:
  Fly   348 GYTSYKRVRRSEASLAQAAKCVSKGETFQTVS----NMFNIPVSTIRFYMARKGILPKRKRGRGA 408

  Fly   498 HHLHHQSAVHHHHHLLTVPPRIERHASEPAPSLAPSTPHLLSVPSSTPYLIKQHSDPLLPRQS-- 560
            .|..:.....:...|.|||..|    :.|     |:.||:             |::||...||  
  Fly   409 SHAGNIIITTNSGKLSTVPASI----THP-----PAHPHI-------------HTNPLPHTQSQQ 451

  Fly   561 ----ALHM-AG----SGSGS-SSAMATGSNP---------FAPLH 586
                :||: ||    |||.| ::|.||..:|         ..|.|
  Fly   452 MSMDSLHLKAGIANTSGSNSPATATATSMSPSFDMATTGDIVPFH 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BtbVIINP_647774.2 BTB 24..117 CDD:279045 46/96 (48%)
BTB 32..117 CDD:197585 43/88 (49%)
CG8924NP_573091.1 BTB 25..117 CDD:279045 44/92 (48%)
BTB 34..117 CDD:197585 41/83 (49%)
MerR 378..407 CDD:278788 4/33 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000318
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23110
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.