DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BtbVII and CG3726

Sequence 1:NP_647774.2 Gene:BtbVII FlyBaseID:FBgn0263108 Length:907 Species:Drosophila melanogaster
Sequence 2:NP_001284917.1 Gene:CG3726 FlyBaseID:FBgn0029824 Length:682 Species:Drosophila melanogaster

Alignment Length:569 Identity:144/570 (25%)
Similarity:214/570 (38%) Gaps:169/570 (30%)


  Fly     1 MSVQQFCLRWNNHQPNFISVCSSLLHNGTLVDVTLAAEGRQLQAHKIVLSACSSYFQALFTTNPC 65
            |..||:||||..|..|..::.|.||..|...|||||.||:.::||::||.|||::|.|:.:....
  Fly     1 MLPQQYCLRWKYHHSNLQTMFSQLLDRGCFCDVTLACEGQLIRAHRVVLCACSTFFDAVLSNYAS 65

  Fly    66 QH-PIVILKDVQYDDLKTMVDFMYYGEVNVSQEQLPHILKTAEMLKIKGLAEM------------ 117
            :. ||:|:|||.:.::|.:::|||.||:||....||.:||||:.||||||||:            
  Fly    66 ERDPIIIMKDVTFAEVKCLIEFMYKGEINVEHSSLPSLLKTADDLKIKGLAEVTWRDDEDGPPPP 130

  Fly   118 ---------------------------------PTDPANLTKS--------------DSKSSTDG 135
                                             ...|.||..|              |.:..:.|
  Fly   131 MAAAEFHSPPRSLAESYAQDLILQHQQQQQQGPAAPPLNLHSSAALLERDRERERERDRERLSPG 195

  Fly   136 TE-MVGGAGVGTGAGNSAGSLGAGSGSSVGDSLWSSSEAQQFQQQQQQQ---------------- 183
            .| ::|...|.|....::||.|.||.|. |.||...:..:.|...::::                
  Fly   196 MEGVLGRMPVMTPLTGASGSAGVGSVSG-GTSLEGVAPVEHFLGPKRKRGRPPLDDAYDVFNVRK 259

  Fly   184 ----------AQQQAQQQHHHHQQQQQL-----------------QQQQQQAQQQQQQQQHHHHH 221
                      ||:...:...|..::..|                 |:|:.:.|||||||......
  Fly   260 LAQYAANLEPAQRAYLETARHFTEEPPLAAHAASMASPPAACPPKQRQRLRHQQQQQQQLLQSES 324

  Fly   222 HQQQQSGQAQAAQTHHHQMRRTPSPLSAGTSPATRRKRLRKSSNNGSGDRNNAEEQHNSSLDAGS 286
            ..|:|....|...........||..||.|.:        .|....| ||     |...:.|...|
  Fly   325 SDQEQPAAGQDWSNLEPNGSATPKLLSDGDA--------NKQETEG-GD-----ESLPAVLTTAS 375

  Fly   287 GAGNAGLSLAQMNQMTFGAGGGLAGHSLHAAKLLKESASAELEQQPQDSD--------LDDGH-- 341
            .:|...|.       ..|......|...||.:|.::|...|::...::.|        :::.|  
  Fly   376 SSGTKKLE-------KIGERRERHGKLRHARRLYEKSGEDEVDPPKEEPDELPQPVEEIENEHLV 433

  Fly   342 GHLHMQIKPEVDI---------GGVNQTMPLDISGGTTPS----------EHD-------APNSQ 380
            .:.....:|.|.|         |||  |.....||..|.|          ||.       |||..
  Fly   434 ANRAESPRPTVVIPASFACKYEGGV--TAAGGGSGSGTGSGSLGSSYLINEHGMLMAHEFAPNVA 496

  Fly   381 SSHSEPSPAHAPHPPHPPLGAASSSSGGSGSFERSFSIGGVGSVECDPD 429
            |:.:..:.|.|     ....|.:::|.|:|:..:..|..|.|:....||
  Fly   497 SAAATAAVAVA-----AAAAAVANASAGNGNGGQDVSGSGTGAAADYPD 540

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BtbVIINP_647774.2 BTB 24..117 CDD:279045 47/94 (50%)
BTB 32..117 CDD:197585 44/86 (51%)
CG3726NP_001284917.1 BTB 21..118 CDD:279045 48/97 (49%)
BTB 32..121 CDD:197585 44/89 (49%)
HTH_psq 587..622 CDD:283007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5233
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000318
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23110
RoundUp 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.