DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BtbVII and CG12236

Sequence 1:NP_647774.2 Gene:BtbVII FlyBaseID:FBgn0263108 Length:907 Species:Drosophila melanogaster
Sequence 2:NP_727050.1 Gene:CG12236 FlyBaseID:FBgn0029822 Length:553 Species:Drosophila melanogaster

Alignment Length:534 Identity:155/535 (29%)
Similarity:231/535 (43%) Gaps:110/535 (21%)


  Fly     2 SVQQFCLRWNNHQPNFISVCSSLLHNGTLVDVTLAAEGRQLQAHKIVLSACSSYFQALFTTNPCQ 66
            :.||:.|||||:..:......:...|...|||:|..:||:::|||:|||:|||||:.:|..||..
  Fly     3 TTQQYSLRWNNYLRHLTYSLDNHRLNDDFVDVSLCVDGRRIKAHKVVLSSCSSYFKEIFKENPHP 67

  Fly    67 HPIVILKDVQYDDLKTMVDFMYYGEVNVSQEQLPHILKTAEMLKIKGLA-------EMPTDPA-- 122
            ||::|.|.::::||.::::|||.|||||.||.|...|:|||:|.::||.       ::|..|.  
  Fly    68 HPVIIFKFIKFEDLNSIIEFMYQGEVNVQQEALQSFLQTAELLAVQGLTAEEKEKPQIPVAPLIS 132

  Fly   123 --NLTK---SDSKSSTDGTEMVGGAGVGTGAGN-----SAGSLGAGSGSSVGDSLWSSSEAQQFQ 177
              .|.|   |..::..:..:.|........|..     :|..|.|.:.|.|...:.:::.|....
  Fly   133 EHKLIKTIPSTIRAVNEQQQQVSNVAQAQTATQTIEIPAATLLQATNASQVPSQVVAAAAAAAAA 197

  Fly   178 QQQQQQAQQQAQQQHHHHQ---------------QQQQLQQQQQQAQQQQQQQQHHHHHHQQQQS 227
            ||.|.|.|   ||||||.|               ||||.||||||.||||||||      |||||
  Fly   198 QQLQVQHQ---QQQHHHVQTTQIQHIQVQSAPPPQQQQQQQQQQQQQQQQQQQQ------QQQQS 253

  Fly   228 GQAQA--AQTHHHQMRRTPSPLSAGTSPATRRKRLRKSSNNGSGDRNNAEEQHNSSLDAGSGAGN 290
            .|.|.  .||.|..:      .:|...||....:.||.:.:...|.....|..:.::....    
  Fly   254 QQQQTTPVQTQHLTI------TNAVALPAASSVKKRKITFSDDDDNMYTTETVDYAVKDEQ---- 308

  Fly   291 AGLSLAQMNQMTF-----------------------GAGGGLAGHSLHAA-----------KLLK 321
               ::.:..:|||                       ||....:..:..||           ::|.
  Fly   309 ---TIVKTAEMTFLRGAVKMDIPDYIVGEVDDRLSDGATPQTSQDATTAAAQNVAQYSSEYEILT 370

  Fly   322 ESASAELEQQPQDSDLDDGHGHLHMQ--IKPEVDIGGVNQTMPLDISGG----TTPSEHDAPNSQ 380
            ||   |:|::.| :|.|:....:.|.  :.......|......::.|||    |.||...:....
  Fly   371 ES---EMEEKYQ-ADADNAEIAIEMTRLLGTASGTPGAGSGQVMEDSGGGSATTGPSTTVSVTQV 431

  Fly   381 SSHSEPSPAHAPHPPHPPLGAASSSSGG------SGSFERSFSIGGVGSVECDPDGTPSSPAVMG 439
            .|.|:.|..:|...|.....|.||.||.      :||.|.|....|:..:.|...|.|...  :.
  Fly   432 KSDSKASGTNAALKPGSVTVARSSKSGATASAPPAGSDEESVQYTGLAPLNCSFCGRPLKS--VN 494

  Fly   440 TKRNRVLTRQPRVK 453
            ..|..:.:|...::
  Fly   495 ALRRHIASRHSEIQ 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BtbVIINP_647774.2 BTB 24..117 CDD:279045 45/100 (45%)
BTB 32..117 CDD:197585 43/92 (47%)
CG12236NP_727050.1 BTB 22..116 CDD:279045 45/94 (48%)
BTB 33..116 CDD:197585 43/83 (52%)
Herpes_capsid <376..467 CDD:283714 21/92 (23%)
C2H2 Zn finger 483..512 CDD:275371 5/29 (17%)
C2H2 Zn finger 514..535 CDD:275371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000318
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23110
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.