DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BtbVII and Nacc2

Sequence 1:NP_647774.2 Gene:BtbVII FlyBaseID:FBgn0263108 Length:907 Species:Drosophila melanogaster
Sequence 2:NP_001094003.1 Gene:Nacc2 RGDID:1309292 Length:585 Species:Rattus norvegicus

Alignment Length:609 Identity:100/610 (16%)
Similarity:187/610 (31%) Gaps:223/610 (37%)


  Fly    15 PNFISVCSSLLHN----GTLVDVTLAAEGRQLQAHKIVLSACSSYFQALFTTN-------PCQHP 68
            |||.:.....|:.    |...||::..:|:..:||:.||:|.|.||:.||:.|       |...|
  Rat    10 PNFGNTVLGCLNEQRLLGLYCDVSIVVKGQAFKAHRAVLAASSLYFRDLFSGNSKSAFELPGTVP 74

  Fly    69 IVILKDVQYDDLKTMVDFMYYGEVNVSQEQLPHILKTAEMLKIKGLAEMPTD------------- 120
            ....:.:        :.|.|.|::.::..:...::.||..|:|:.:.|..||             
  Rat    75 PACFQQI--------LSFCYTGKLTMAASEQLVVMYTAGFLQIQHIVERGTDLMFKVSSPHCDSQ 131

  Fly   121 -------------------PANLTKSDSKS---------STDGTEMV------------------ 139
                               ||....:.|.|         ..:..||.                  
  Rat   132 TAMIEDASSEPQSPCNQLQPATAAYATSPSVPIPLLTRVKHEAMEMPPATGPGLASKRPLDTGPR 196

  Fly   140 GGAGVGTGAGNSAGS----------LGAGSGSSVGDSLWSSSEAQQFQQQQQQQAQQQAQQ---- 190
            .|..|.|||..:.|:          .|..|.:::..|:      ||....|.::....|..    
  Rat   197 DGVAVATGAAGTPGTAPLKLPRVSYYGVPSLATLIPSI------QQVPYPQGERTSPGASSLPTT 255

  Fly   191 ---QHHHHQQQQQLQQQQQQAQQQQQQQQHHHHHHQQQQSGQAQAAQTHHHQMRRTPSPLSAGTS 252
               ..:|::     .:...:|.....::|:          ||.....|.::.::..|.|:...:.
  Rat   256 DSPTSYHNE-----DEDDDEAYDTMVEEQY----------GQMYIKATGNYAVQEKPEPVPLESR 305

  Fly   253 PATRRKR----LRKSSNNGSGDR------NNAEEQHNSSLDAGSGA----GN-------AGL--- 293
            .....:|    |..|..:..|.|      :..:......|.||||.    |.       ||:   
  Rat   306 SCVLIRRDLVALPASLISQIGYRCHPKLYSEGDPGEKLELVAGSGVYITRGQLMNCHLCAGVKHK 370

  Fly   294 --------SLAQMNQMTFGAGGGLAGHS------------LHAAKLLKESASAELEQQPQD---S 335
                    :....|.:....|.|:...:            |:|.||..::.:...::...:   :
  Rat   371 VLLRRLLATFFDRNTLANSCGTGIRSSTSDPSRKPLDSRVLNAVKLYCQNFAPSFKESEMNVIAA 435

  Fly   336 DLDDGHGHLHMQIKPEVD-------------IGGVNQTMPLDISGGTTPSE-----------HDA 376
            |:......:..:..|::.             :|....::|||....:..|:           :||
  Rat   436 DMCTNARRVRKRWLPKIKSMLPEGVEMYRSVMGASAASLPLDPEFPSAASQVFEQRIYAERRNDA 500

  Fly   377 PNSQSSHSEPSPAHAPHPPHPPLGAASSSSGGSGSFERSFSIGGVGSV--------ECDPDG--- 430
            ....:..::..             ....|:..:.:||.:..:.|.|||        :...||   
  Rat   501 ATIVALRTDAV-------------NVDLSTSANPAFEANEEVDGAGSVIQEVAAPEQLPADGQSS 552

  Fly   431 ------------TPSSPAVMGTKR 442
                        .|.:|....|:|
  Rat   553 PQAFEQGNTSSSRPQTPVATATRR 576

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BtbVIINP_647774.2 BTB 24..117 CDD:279045 26/104 (25%)
BTB 32..117 CDD:197585 24/92 (26%)
Nacc2NP_001094003.1 BTB 20..120 CDD:279045 28/108 (26%)
BTB 31..114 CDD:197585 23/91 (25%)
BEN 370..447 CDD:214981 8/77 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5107
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.