DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg2 and GSY2

Sequence 1:NP_647772.1 Gene:Alg2 FlyBaseID:FBgn0035401 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_013359.1 Gene:GSY2 SGDID:S000004248 Length:705 Species:Saccharomyces cerevisiae

Alignment Length:275 Identity:60/276 (22%)
Similarity:89/276 (32%) Gaps:108/276 (39%)


  Fly   175 DTFRRLSTV------------PDVLYPS----LHTQYFDQMQKKLEQRSALLDEPVHPRV----- 218
            |.|..:|.:            ||.:.|:    :..|.|.:.|    ...||..|.::..|     
Yeast   242 DVFTTVSQITAFEAEHLLKRKPDGILPNGLNVIKFQAFHEFQ----NLHALKKEKINDFVRGHFH 302

  Fly   219 -----PLNAFIYLDI-NRYERKKN------HALAL--HSLRLLGD--------MLPATDFKRCRL 261
                 .|:..:|..| .|||.|..      .|||.  :.|::.|.        ::||.:......
Yeast   303 GCFDFDLDNTLYFFIAGRYEYKNKGADMFIEALARLNYRLKVSGSKKTVVAFIVMPAKNNSFTVE 367

  Fly   262 IIAGGYDTRCMENV-------------EHFAELEH----------LTEELKLQDHVVLLRSPTDE 303
            .:.|..:.|.:||.             :|.....|          |.|.||..|.|:|.|     
Yeast   368 ALKGQAEVRALENTVHEVTTSIGKRIFDHAIRYPHNGLTTELPTDLGELLKSSDKVMLKR----- 427

  Fly   304 EKCRLLFAAHCLLYTPENEHFGIVPLEGMYCSKPVVALNSGGPTETVVSTSTGFLCEKTEKSFGG 368
               |:|     .|..||    |.:|        |:|       |..:|..:...:..|..:    
Yeast   428 ---RIL-----ALRRPE----GQLP--------PIV-------THNMVDDANDLILNKIRQ---- 461

  Fly   369 AMLQLFRDEQLRVKM 383
              :|||.....||||
Yeast   462 --VQLFNSPSDRVKM 474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg2NP_647772.1 RfaB 1..412 CDD:223515 60/276 (22%)
GT1_ALG2_like 2..404 CDD:99977 60/276 (22%)
GSY2NP_013359.1 GT1_Glycogen_synthase_GSY2_like 7..616 CDD:99967 60/276 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.