DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg2 and AT3G15940

Sequence 1:NP_647772.1 Gene:Alg2 FlyBaseID:FBgn0035401 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001189906.1 Gene:AT3G15940 AraportID:AT3G15940 Length:697 Species:Arabidopsis thaliana

Alignment Length:283 Identity:65/284 (23%)
Similarity:109/284 (38%) Gaps:57/284 (20%)


  Fly   157 GLADK-VLVNSKFTLRVFQDTFRRLSTVPDVLYPSLHTQYFDQMQKKLEQRSALLDEPVHPRVPL 220
            ||.|| :||.|..::...:.....|.:|...|..       :|.|:::.:|:             
plant   431 GLTDKDMLVMSLSSINPGKGQLLLLESVALALER-------EQTQEQVAKRN------------- 475

  Fly   221 NAFIYLDINRYERKKNHALALHSLRLLGDML----PATD--------FKRCRLIIAGG----YDT 269
            .:.|..::|...::|....|.|.||.....:    ||.|        ..|.:|:::|.    .|.
plant   476 QSKIIKNLNGIRKEKISLSARHRLRGSSRKMKITSPAVDNHPSVLSATGRRKLLLSGNVTQKQDL 540

  Fly   270 RCM--------ENVEHFAE-LEHLTEELKLQDHVVLLRSPTDEEKCRLLFAAHCLLYTPE--NEH 323
            :.:        ..|.:..| |..|:....|.:.|  |.:|.......|..||...:...:  .|.
plant   541 KLLLGSVGSKSNKVAYVKEMLSFLSNNGNLSNSV--LWTPATTRVASLYSAADVYVTNSQGVGET 603

  Fly   324 FGIVPLEGMYCSKPVVALNSGGPTETVVSTSTGFL---CEKTEKSFGGAMLQLFRDEQLRVKMGD 385
            ||.|.:|.|....||:..::||..|.|....||.|   .....|.....:|.|.|:...|:::|.
plant   604 FGRVTIEAMAYGLPVLGTDAGGTKEIVEHNVTGLLHPVGRAGNKVLAQNLLFLLRNPSTRLQLGS 668

  Fly   386 QGHKRVQQKF----SFQAFADRL 404
            ||.:.|::.:    .::.|.|.|
plant   669 QGREIVEKMYMKQHMYKRFVDVL 691

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg2NP_647772.1 RfaB 1..412 CDD:223515 65/284 (23%)
GT1_ALG2_like 2..404 CDD:99977 64/282 (23%)
AT3G15940NP_001189906.1 Glyco_trans_4_5 234..404 CDD:293599
RfaB <536..697 CDD:223515 39/159 (25%)
Glycosyltransferase_GTB_type <569..691 CDD:299143 33/124 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.