DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg2 and piga

Sequence 1:NP_647772.1 Gene:Alg2 FlyBaseID:FBgn0035401 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001119918.1 Gene:piga ZFINID:ZDB-GENE-040426-1086 Length:487 Species:Danio rerio

Alignment Length:445 Identity:96/446 (22%)
Similarity:169/446 (38%) Gaps:109/446 (24%)


  Fly     6 FLHPDLGIGGAERLVVDAALALKERGHQVSFLTNHHDSTHCFKETADGTFPVHVVGD-----WLP 65
            |.:|::  ||.|..:...:..|.|:||:|...|                   |..||     :|.
Zfish    45 FFYPNM--GGVESHIYQLSQCLIEKGHKVVIAT-------------------HAYGDRRGIRYLT 88

  Fly    66 RGLFGRFYAICAYLRMLY-AAIYASFFMPQREQVDVVVCDLISVCIPVLRFAPHRPKVLFYCHFP 129
            .||  :.|.:  .|:::| .:...:.|    ..:.::.|..:..||.::.  .|..   |.....
Zfish    89 NGL--KVYYL--PLQVMYNQSTSTTCF----HSLPLLRCIFVRECITIVH--AHSS---FSAMAH 140

  Fly   130 DQLLSSREGLLKRLYRLPINWLEEHTI-GLAD--KVLVNSKFTLRVFQDTFRRLSTVPDVLYPSL 191
            |.|..::...|..::       .:|:: |.||  .||.|...|:.:. ||    :.:..|.|.| 
Zfish   141 DALFHAKTMGLNTVF-------TDHSLFGFADLSSVLTNKLLTVSLC-DT----NHIVCVSYTS- 192

  Fly   192 HTQYFDQMQKKLEQRSALLDEPVHPRVPLNAFIYLDINRYE-RKKNHALAL---------HSLRL 246
                     |:.....|.||..:...:| ||....|..... |:.|..:.:         ..:.|
Zfish   193 ---------KENTVLRATLDPEIVSVIP-NAVDPTDFTPDPCRRDNSKITIVVISRLVYRKGIDL 247

  Fly   247 LGDMLPATDFKRCRLIIAGGYDTRCM----ENVEHFAELEHLTEELKLQDHVVLLRSPTDEEKCR 307
            |..::|.         :.|.:...|.    |..:... ||.:.|:.:|.|.|.||.:...::...
Zfish   248 LSGIIPE---------LCGRHPDLCFLIGGEGPKRII-LEEVREKYQLHDRVRLLGALDHKDVRD 302

  Fly   308 LLFAAHCLLYTPENEHFGIVPLEGMYCSKPVVALNSGG-----PTE--TVVSTSTGFLCEKTEKS 365
            :|...|..|.|...|.|.:..:||..|...||:...||     |.|  |:...|...||:..|  
Zfish   303 VLVQGHIFLNTSLTEAFCMAIVEGASCGLQVVSTRVGGIPEVLPNELVTLCGPSVCSLCDGLE-- 365

  Fly   366 FGGAMLQLFRDEQLRVKMGDQGHKRVQQKFSFQAFADR----LNGIIRD-LVPIS 415
               .:::..|..  .|:.....|::|:..::::..|:|    .|.:.|: ::|:|
Zfish   366 ---TVIKKIRSG--NVESPAAIHRKVRTLYTWRNVAERTEKVYNRVCREPVLPLS 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg2NP_647772.1 RfaB 1..412 CDD:223515 94/441 (21%)
GT1_ALG2_like 2..404 CDD:99977 92/432 (21%)
pigaNP_001119918.1 GT1_PIG-A_like 38..437 CDD:99970 96/446 (22%)
RfaB 39..409 CDD:223515 94/438 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.