DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg2 and Gys1

Sequence 1:NP_647772.1 Gene:Alg2 FlyBaseID:FBgn0035401 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001103085.1 Gene:Gys1 RGDID:1589798 Length:738 Species:Rattus norvegicus

Alignment Length:196 Identity:37/197 (19%)
Similarity:62/197 (31%) Gaps:48/197 (24%)


  Fly   230 RYERKKNHALALHSLRLLGDMLPATDFKRCRLIIAG----GYDTRCMEN------------VEHF 278
            ::.||...:|.:.||..:..||...||...:..|..    .:...|..|            :...
  Rat   399 KFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRI 463

  Fly   279 AELEHLTEELKLQDHVVLLRS-----PTDEEKCRLLFAAHCLLYTPENEHFGIVPLEGMYCSKPV 338
            .......:.:|:..|...|.|     |.|.|:  .:...|..::....|.:|..|.|......|.
  Rat   464 GLFNSSADRVKVIFHPEFLSSTSPLLPVDYEE--FVRGCHLGVFPSYYEPWGYTPAECTVMGIPS 526

  Fly   339 VALNSGG-----------PT--------------ETVVSTSTGFLCEKTEKSFGGAMLQLFRDEQ 378
            ::.|..|           |:              :...|..|.||....::|....::|..|.|:
  Rat   527 ISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTER 591

  Fly   379 L 379
            |
  Rat   592 L 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg2NP_647772.1 RfaB 1..412 CDD:223515 37/197 (19%)
GT1_ALG2_like 2..404 CDD:99977 37/197 (19%)
Gys1NP_001103085.1 GT1_Glycogen_synthase_GSY2_like 26..615 CDD:99967 37/197 (19%)
Glycogen_syn 31..663 CDD:283373 37/197 (19%)
RGCC 645..>732 CDD:291809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.