DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg2 and ALG1L2

Sequence 1:NP_647772.1 Gene:Alg2 FlyBaseID:FBgn0035401 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001129624.1 Gene:ALG1L2 HGNCID:37258 Length:215 Species:Homo sapiens

Alignment Length:205 Identity:45/206 (22%)
Similarity:64/206 (31%) Gaps:71/206 (34%)


  Fly   212 EPVHPRVPLNAFIYLDINRYERKKNHALA--LHSLRLLGDMLPATDFKRCRLIIAGGYDTRCMEN 274
            ||..|....:||.       ||.....|.  ||              :|..|:::.         
Human    46 EPEDPDTERSAFT-------ERDSGSGLVTRLH--------------ERPALLVSS--------- 80

  Fly   275 VEHFAELEHLT---EELKLQDHVVLLRSPTDEEKCRLLFAAH------CLLYTPENEHFGIVPLE 330
             ..:.|.|.||   :.|.....|:..:.|..|...||:...|      |:   |..|..|:.||.
Human    81 -TSWTEFEQLTLDGQNLPSLVCVITGKGPLREYYSRLIHQKHFQHIQVCI---PWLEGRGLPPLL 141

  Fly   331 G-----------------------MY-CSKPVVALNSGGPTETVVSTSTGFLCEKTEKSFGGAML 371
            |                       |: |..|..|:|.....|.|.......:.|.:|:.  .|.|
Human   142 GSVDLDVCLDTSSSGLDLPMKVVDMFRCCLPACAVNFKCLHELVKHEENRLVFEDSEEL--AAQL 204

  Fly   372 QLFRDEQLRV 381
            |.|.|..|::
Human   205 QYFADAFLKL 214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg2NP_647772.1 RfaB 1..412 CDD:223515 45/206 (22%)
GT1_ALG2_like 2..404 CDD:99977 45/206 (22%)
ALG1L2NP_001129624.1 Glycosyltransferase_GTB_type <8..206 CDD:299143 42/196 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.