| Sequence 1: | NP_647772.1 | Gene: | Alg2 / 38374 | FlyBaseID: | FBgn0035401 | Length: | 424 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001129624.1 | Gene: | ALG1L2 / 644974 | HGNCID: | 37258 | Length: | 215 | Species: | Homo sapiens |
| Alignment Length: | 205 | Identity: | 45/205 - (21%) |
|---|---|---|---|
| Similarity: | 64/205 - (31%) | Gaps: | 71/205 - (34%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 212 EPVHPRVPLNAFIYLDINRYERKKNHALA--LHSLRLLGDMLPATDFKRCRLIIAGGYDTRCMEN 274
Fly 275 VEHFAELEHLT---EELKLQDHVVLLRSPTDEEKCRLLFAAH------CLLYTPENEHFGIVPLE 330
Fly 331 G-----------------------MY-CSKPVVALNSGGPTETVVSTSTGFLCEKTEKSFGGAML 371
Fly 372 QLFRDEQLRV 381 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Alg2 | NP_647772.1 | RfaB | 1..412 | CDD:223515 | 45/205 (22%) |
| GT1_ALG2_like | 2..404 | CDD:99977 | 45/205 (22%) | ||
| ALG1L2 | NP_001129624.1 | Glycosyltransferase_GTB_type | <8..206 | CDD:299143 | 41/195 (21%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 40..66 | 7/26 (27%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0438 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||