DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg2 and alg2

Sequence 1:NP_647772.1 Gene:Alg2 FlyBaseID:FBgn0035401 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001025660.1 Gene:alg2 XenbaseID:XB-GENE-494529 Length:404 Species:Xenopus tropicalis

Alignment Length:412 Identity:206/413 (50%)
Similarity:271/413 (66%) Gaps:16/413 (4%)


  Fly     4 VLFLHPDLGIGGAERLVVDAALALKERGHQVSFLTNHHDSTHCFKETADGTFPVHVVGDWLPRGL 68
            |||:|||||||||||||||||||||.||..|...|:|:|..|||.||.|...|:...||||||.|
 Frog     5 VLFVHPDLGIGGAERLVVDAALALKSRGCHVQVWTSHYDPDHCFSETRDSGIPIRCCGDWLPRSL 69

  Fly    69 FGRFYAICAYLRMLYAAIYASFFMPQREQVDVVVCDLISVCIPVLRFAPHRPKVLFYCHFPDQLL 133
            .||.:|:|||:||::..:|..|.  ..|:.|||.||.:|.|||..:.|....|||||||||||||
 Frog    70 LGRCHALCAYIRMIFLTLYIVFL--SGEEFDVVFCDQVSACIPFFKLARDSKKVLFYCHFPDQLL 132

  Fly   134 SSREGLLKRLYRLPINWLEEHTIGLADKVLVNSKFTLRVFQDTFRRLSTV-PDVLYPSLHTQYFD 197
            :.|..|:||:||.||:||||.|.|:||.:||||.||..:|::||..|:.: |.||||||:...|:
 Frog   133 TQRLSLVKRMYRAPIDWLEEKTTGMADCILVNSYFTSAIFKETFASLAHIEPTVLYPSLNVSNFE 197

  Fly   198 QMQKKLEQRSALLDE--PVHPRVPLNAFIYLDINRYERKKNHALALHSLRLLGDMLPATDFKRCR 260
                     |.:.::  .:.|....|  |:|.|||:|||||..|||.|:..|...|...:::|..
 Frog   198 ---------STVFEDVSDLFPAKRQN--IFLSINRFERKKNLHLALESMCKLRKRLSLLEWERVH 251

  Fly   261 LIIAGGYDTRCMENVEHFAELEHLTEELKLQDHVVLLRSPTDEEKCRLLFAAHCLLYTPENEHFG 325
            ||:|||||.|.:|||||:.||:....:..:.:||..|||.:||:|..||..|.|:||||.|||||
 Frog   252 LILAGGYDERVLENVEHYVELKESAVKYDISNHVTFLRSFSDEQKRNLLHNAICVLYTPSNEHFG 316

  Fly   326 IVPLEGMYCSKPVVALNSGGPTETVVSTSTGFLCEKTEKSFGGAMLQLFRDEQLRVKMGDQGHKR 390
            |||:|.||...||:|:|||||.|:|.:..|||||....:.|..||.:..::..|:.:||:.||.|
 Frog   317 IVPIEAMYMRCPVIAVNSGGPLESVENNVTGFLCSPNPEQFADAMEKFVKNPDLKNRMGESGHIR 381

  Fly   391 VQQKFSFQAFADRLNGIIRDLV 412
            |:.|||.:||:|::...:..|:
 Frog   382 VKSKFSTEAFSDQIYAHVCKLI 403

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg2NP_647772.1 RfaB 1..412 CDD:223515 206/411 (50%)
GT1_ALG2_like 2..404 CDD:99977 205/403 (51%)
alg2NP_001025660.1 GT1_ALG2_like 4..395 CDD:99977 205/403 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C210163905
eggNOG 1 0.900 E1_COG0438
Hieranoid 1 1.000
Homologene 1 1.000 H5930
Inparanoid 1 1.050 397 1.000 Inparanoid score I1795
OMA 1 1.010
OrthoDB 1 1.010 D1339573at2759
OrthoFinder 1 1.000 FOG0003612
OrthoInspector 1 1.000 T1061289
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R41
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.