DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg2 and ALG11

Sequence 1:NP_647772.1 Gene:Alg2 FlyBaseID:FBgn0035401 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001004127.2 Gene:ALG11 HGNCID:32456 Length:492 Species:Homo sapiens

Alignment Length:452 Identity:105/453 (23%)
Similarity:188/453 (42%) Gaps:92/453 (20%)


  Fly     4 VLFLHP--DLGIGGAERLVVDAALALKERGHQVSFLTNHHDSTHCFKETADGTFPVHVVGDWLPR 66
            :.|.||  :.| ||.||::..|..||:::..:..::....|              |:|.|..:..
Human    65 IAFFHPYCNAG-GGGERVLWCALRALQKKYPEAVYVVYTGD--------------VNVNGQQILE 114

  Fly    67 GLFGRFY------AICAYLRMLYA---AIYASFFMPQREQVDVVV-CDLISVCIP-----VLRFA 116
            |.|.||.      ....:||..|.   ::|..|.:..:....:.: .:.:..|:|     .:.:|
Human   115 GAFRRFNIRLIHPVQFVFLRKRYLVEDSLYPHFTLLGQSLGSIFLGWEALMQCVPDVYIDSMGYA 179

  Fly   117 PHRP--------KVLFYCHFP---DQLLS---------------SREGLLKRLYRLPINWLEEHT 155
            ...|        :|..|.|:|   ..:||               :|...|.:: :|...:|....
Human   180 FTLPLFKYIGGCQVGSYVHYPTISTDMLSVVKNQNIGFNNAAFITRNPFLSKV-KLIYYYLFAFI 243

  Fly   156 IGL----ADKVLVNSKFTLRVFQDTFRRLSTVPDVLYPSLHTQYFDQMQKKLEQRSALLDEPVHP 216
            .||    :|.|:|||.:||......: ::....:::||....|.|             ||.|:|.
Human   244 YGLVGSCSDVVMVNSSWTLNHILSLW-KVGNCTNIVYPPCDVQTF-------------LDIPLHE 294

  Fly   217 RVPLNAFIYLDINRYERKKNHALALHSLRLLGDMLPATDFKRCRLIIAGGYDTRCMENVEHFAEL 281
            :......:.:.:.::..:|||.|.:.:...|.:..........:|::.||  .|..::.....:|
Human   295 KKMTPGHLLVSVGQFRPEKNHPLQIRAFAKLLNKKMVESPPSLKLVLIGG--CRNKDDELRVNQL 357

  Fly   282 EHLTEELKLQDHVVL-LRSPTDEEKCRLLFAAHCLLYTPENEHFGIVPLEGMYCSKPVVALNSGG 345
            ..|:|:|.:|::|.. :..|.||.| ..|..|...|:|..||||||..:|.|.....::|.||||
Human   358 RRLSEDLGVQEYVEFKINIPFDELK-NYLSEATIGLHTMWNEHFGIGVVECMAAGTIILAHNSGG 421

  Fly   346 PTETVV----STSTGFLCEKTEKSFG---GAMLQLFRDEQLRVKMGDQGHKRVQQKFSFQAF 400
            |...:|    ...||||.| :|:.:.   ..:|.:..:::|:::   :..:....:||.|.|
Human   422 PKLDIVVPHEGDITGFLAE-SEEDYAETIAHILSMSAEKRLQIR---KSARASVSRFSDQEF 479

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg2NP_647772.1 RfaB 1..412 CDD:223515 105/453 (23%)
GT1_ALG2_like 2..404 CDD:99977 105/453 (23%)
ALG11NP_001004127.2 GT1_ALG11_like 63..480 CDD:99978 105/453 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.