DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg2 and GlyS

DIOPT Version :9

Sequence 1:NP_647772.1 Gene:Alg2 / 38374 FlyBaseID:FBgn0035401 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_731967.2 Gene:GlyS / 41823 FlyBaseID:FBgn0266064 Length:709 Species:Drosophila melanogaster


Alignment Length:190 Identity:41/190 - (21%)
Similarity:64/190 - (33%) Gaps:62/190 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 DMLPATD---FKRCRLI-------------IAGGYDTRCMENVE--HFAELEHLTEELKLQDHVV 295
            |:|...|   .|||...             :|..::...:.::.  |.....|  :.:|:..|..
  Fly   449 DLLQKDDLVKIKRCMFAMQRDSMPPVTTHNVADDWNDPVLSSIRRCHLFNSRH--DRVKMVFHPE 511

  Fly   296 LLRSPTD------EEKCRLLFAAHCLLYTPENEHFGIVPLEGMYCSKPVVALNSGGPTETVVSTS 354
            .|.|...      ||..|   ..|..::....|.:|..|.|   |:  |:.:.|      |.:..
  Fly   512 FLTSTNPLFGIDYEEFVR---GCHLGVFPSYYEPWGYTPAE---CT--VMGIPS------VTTNL 562

  Fly   355 TGFLCEKTE-----KSFGGAMLQLFRDEQLRVKMGDQGH----KRVQQKFSFQAFADRLN 405
            :||.|...|     ||:|             :.:.|:.:    ..|||..||.....|||
  Fly   563 SGFGCFMEEHISDPKSYG-------------IYIVDRRYIGLENSVQQLSSFMMEFSRLN 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg2NP_647772.1 RfaB 1..412 CDD:223515 41/190 (22%)
GT1_ALG2_like 2..404 CDD:99977 38/187 (20%)
GlySNP_731967.2 Glycogen_syn 53..697 CDD:399009 41/190 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.