DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg2 and alg11

Sequence 1:NP_647772.1 Gene:Alg2 FlyBaseID:FBgn0035401 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_989283.1 Gene:alg11 XenbaseID:XB-GENE-5934131 Length:487 Species:Xenopus tropicalis

Alignment Length:465 Identity:110/466 (24%)
Similarity:184/466 (39%) Gaps:121/466 (26%)


  Fly     4 VLFLHP--DLGIGGAERLVVDAALALKERGHQVSFLTNHHDSTHCFKETADG---------TFPV 57
            |.|.||  :.| ||.||::..|..:|::|.....::....|.....::..:|         :.||
 Frog    63 VAFFHPYCNAG-GGGERVLWCALRSLQKRYKDAIYVIYTGDKDVSEEQILNGAAARFNIKLSHPV 126

  Fly    58 HVVGDWL-PRGLFGRFYAICAYLRMLYAAIYASFFMPQREQVDVVV-CDLISVCIP-----VLRF 115
            ..:  :| .|||             :.|:.|..|.:..:....||: .:.::.|:|     .:.:
 Frog   127 KFI--FLEKRGL-------------VEASFYPRFTLLGQSLGSVVLGWEALTKCVPDIYIDSMGY 176

  Fly   116 APHRP--------KVLFYCHFPD---QLLS---------------SREGLLKR-------LYRLP 147
            |...|        :|..|.|:|.   .:||               |...:|.|       |:.:.
 Frog   177 AFTLPLFKYVGGCQVGCYVHYPTISMDMLSVVRSQNARFNNAAFISNNPVLSRLKLIYYYLFAVI 241

  Fly   148 INWLEEHTIGLADKVLVNSKFTLRVFQDTFRRLSTVPDVLYPSLHTQYFDQMQKKLEQRSALLDE 212
            ..|:.    ..:|.::|||.:|.....|.: :.|....::||....|.|             ||.
 Frog   242 YGWVG----SCSDVIMVNSTWTFAHILDLW-KCSERTSIVYPPCDVQTF-------------LDI 288

  Fly   213 PVHPRVPLNAFIYLDINRYERKKNHALALHSLRLLGDMLPATDFKRCRLIIAGGYDTRCMENVEH 277
            .::....:.....:.|.::..:|:|.|.:.:...|... ..|:..:.:||:.||    |..|.:.
 Frog   289 NLNQHKDIEEHSIVSIGQFRPEKDHPLQICAFAALLKK-KTTEKLKLKLILIGG----CRNNEDE 348

  Fly   278 F--AELEHLTEELKLQDHVVLLRSPTDEEKCRLLFA--------AHCLLYTPENEHFGIVPLEGM 332
            .  :||:.|:.||.:         |. |.|..:.||        |...|:|..||||||..:|.|
 Frog   349 LRVSELKKLSSELGI---------PV-EFKVNIPFAELKKHLSEATIGLHTMWNEHFGIGIVECM 403

  Fly   333 YCSKPVVALNSGGPTETVV----STSTGFLCEKTEKSFGGAM---LQLFRDEQLRVKMGDQGHKR 390
            .....::|.|||||...:|    ...||||.:..| |:..||   |.|..:::|.::   |..:|
 Frog   404 AAGTIILAHNSGGPKLDIVVPYEEHETGFLADSVE-SYAAAMDYILCLTPEQRLTIR---QNARR 464

  Fly   391 VQQKFSFQAF 400
            ...:||.|.|
 Frog   465 SVARFSDQEF 474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg2NP_647772.1 RfaB 1..412 CDD:223515 110/466 (24%)
GT1_ALG2_like 2..404 CDD:99977 110/466 (24%)
alg11NP_989283.1 GT1_ALG11_like 61..477 CDD:99978 110/466 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.