DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg2 and Piga

Sequence 1:NP_647772.1 Gene:Alg2 FlyBaseID:FBgn0035401 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_006256932.1 Gene:Piga RGDID:1589723 Length:485 Species:Rattus norvegicus

Alignment Length:457 Identity:89/458 (19%)
Similarity:167/458 (36%) Gaps:123/458 (27%)


  Fly     6 FLHPDLGIGGAERLVVDAALALKERGHQVSFLTNHHDSTHCFKETADGTFPVHVVGD-----WLP 65
            |.:|::  ||.|..:...:..|.||||:|..:|                   |..|:     :|.
  Rat    41 FFYPNM--GGVESHIYQLSQCLIERGHKVITVT-------------------HAYGNRKGVRYLT 84

  Fly    66 RGLFGRFYAICAYLRMLYAAIYASFFMPQREQVDVVVCDLISVCIPVLRFAPHRPKV-LFYCHFP 129
            .||                   ..:::|.|...:......:...:|:||:...|.:: :.:.|..
  Rat    85 NGL-------------------KVYYLPLRVMYNQSTATTLFHSLPLLRYIFVRERITIIHSHSS 130

  Fly   130 ------DQLLSSREGLLKRLYRLPINWLEEHTI-GLAD--KVLVNSKFTLRVF------------ 173
                  |.|..::...|:.::       .:|:: |.||  .||.|...|:.:.            
  Rat   131 FSAMAHDALFHAKTMGLQTVF-------TDHSLFGFADVSSVLTNKLLTVSLCDTNHIICVSYTS 188

  Fly   174 -QDTFRR-------LSTVPDVLYPSLHTQYFDQMQKKLEQRSALLDEPVHPRVPLNAFIYLDINR 230
             ::|..|       :|.:|:.:.|:      |...:...:..:::...|..|:     :|     
  Rat   189 KENTVLRAALNPEIVSVIPNAVDPT------DFTPEPFRRHDSVITVVVVSRL-----VY----- 237

  Fly   231 YERKKNHALALHSLRLLGDMLP--ATDFKRCRLIIAGGYDTRCMENVEHFAELEHLTEELKLQDH 293
              ||        ...||..::|  ...::....:|.|....|.:        ||.:.|..:|.|.
  Rat   238 --RK--------GTDLLSGIIPELCQKYQELNFLIGGEGPKRII--------LEEVRERYQLHDR 284

  Fly   294 VVLLRSPTDEEKCRLLFAAHCLLYTPENEHFGIVPLEGMYCSKPVVALNSGGPTETVVSTSTGFL 358
            |.||.:...::...:|...|..|.|...|.|.:..:|...|...||:...||..| |:..:...|
  Rat   285 VQLLGALEHKDVRNVLVQGHIFLNTSLTEAFCMAIVEAASCGLQVVSTKVGGIPE-VLPENLIIL 348

  Fly   359 CEKTEKSF-GGAMLQLFRDEQLRVKMGDQGHKRVQQKFSFQAFADRLNGIIRDLVPISRESSAKK 422
            ||.:.||. .|....:|:.:...:...:..|..|:..::::..|:|...:..   .:|:||....
  Rat   349 CEPSVKSLCEGLEKAIFQVKSGTLPAPENIHNVVKTFYTWRNVAERTEKVYE---RVSKESVLPM 410

  Fly   423 NK 424
            :|
  Rat   411 HK 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg2NP_647772.1 RfaB 1..412 CDD:223515 85/444 (19%)
GT1_ALG2_like 2..404 CDD:99977 85/436 (19%)
PigaXP_006256932.1 GT1_PIG-A_like 34..433 CDD:99970 89/458 (19%)
RfaB 34..406 CDD:223515 87/450 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.