DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg2 and Alg1

Sequence 1:NP_647772.1 Gene:Alg2 FlyBaseID:FBgn0035401 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_663337.2 Gene:Alg1 MGIID:2384774 Length:482 Species:Mus musculus

Alignment Length:398 Identity:85/399 (21%)
Similarity:141/399 (35%) Gaps:114/399 (29%)


  Fly    66 RGLFGRFYAICAY-LRMLYAAIYASFFMPQREQV------------DVVVCDLIS-VC------- 109
            ||| |....|..| :::::.|:|..:.|.:.:..            .:.||..:. :|       
Mouse    92 RGL-GAGPRILQYGVKVVFQAVYLLWKMMRMDPAAYIFLQNPPGLPAIAVCWFVGCICGSKLVID 155

  Fly   110 -------IPVLRFAPHRPKVL---FYCHFPDQLL--------SSREGLLKR-------LYRLPIN 149
                   |..|...|..|.||   :|..|..:|.        :.||.|.:.       ||..|.:
Mouse   156 WHNYGYSIMGLVHGPRHPIVLLAKWYEKFFGRLSHLNLCVTNAMREDLAENWCVRAVTLYDKPAS 220

  Fly   150 WLEEHTIGLADKVLVNSKFTLRVFQDTFRRLSTVPDVLYPSLHTQYFDQ------MQKKLEQRSA 208
            :.:|..:.|..::.:....|...||       :..|..:|......|.:      :.::|..|.|
Mouse   221 FFKETPLDLQHELFMKLSHTYSPFQ-------SCSDPSHPDTERSAFTERDCQSGVVRRLHGRPA 278

  Fly   209 LLDEPVHPRVPLNAFIYLDINRYERKKNHALALHSLR------LLGDMLPATDFKRCRLIIAGGY 267
            ||               :....:...::.::.|.:|.      |.||.||:.   .|  :|.|..
Mouse   279 LL---------------VSSTSWTEDEDFSILLRALEKFEQQALTGDSLPSL---VC--VITGKG 323

  Fly   268 DTRCMENVEHFAELEHL------TEELKLQDHVVLLRSPTDEEKCRLLFAAHCLLYTPENEHFGI 326
            ..|  |:..|....:||      |..|:.:|:.:||.| .|...|..:.::...|.....:.|| 
Mouse   324 PLR--EHYRHLISQKHLQHVRFCTPWLEAEDYPLLLGS-ADLGVCLHMSSSGLDLPMKVVDMFG- 384

  Fly   327 VPLEGMYCSKPVVALNSGGPTETVVSTSTGFLCEKTEKSFGGAMLQL----FRD-----EQLRVK 382
                   |..||.|:|.....|.|.....|.:.:..|:.  .|.||:    |.|     .|.|.|
Mouse   385 -------CHLPVCAVNFKCLHELVRHGENGLVFKDAEEL--AAQLQMLFSKFPDPAGKLSQFRKK 440

  Fly   383 MGDQGHKR 390
            :.:.|.:|
Mouse   441 LQESGQQR 448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg2NP_647772.1 RfaB 1..412 CDD:223515 85/399 (21%)
GT1_ALG2_like 2..404 CDD:99977 85/399 (21%)
Alg1NP_663337.2 PLN02275 29..424 CDD:215155 78/373 (21%)
GT1_ALG1_like 33..461 CDD:99986 85/399 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.