DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg2 and Alg11

Sequence 1:NP_647772.1 Gene:Alg2 FlyBaseID:FBgn0035401 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001230090.1 Gene:Alg11 MGIID:2142632 Length:492 Species:Mus musculus

Alignment Length:457 Identity:112/458 (24%)
Similarity:188/458 (41%) Gaps:101/458 (22%)


  Fly     4 VLFLHP--DLGIGGAERLVVDAALALKERGHQVSFLTNHHDSTHCFKETADGTFPVHVVGDWLPR 66
            |.|.||  :.| ||.||::..|..||:::..:..::....|              ::|.|..:..
Mouse    65 VAFFHPYCNAG-GGGERVLWCALRALQKKYPEAVYVVYTGD--------------INVSGQQILD 114

  Fly    67 GLFGRFYAICA------YLRMLYA---AIYASFFM-------------PQREQVDVVVCDLI--S 107
            |.|.||....|      :||..|.   :.|..|.:             ...::|..|..|.:  :
Mouse   115 GAFRRFNIKLAHPVQFVFLRKRYLVEDSRYPHFTLLGQSLGSILLGWEALMQRVPDVYIDSMGYA 179

  Fly   108 VCIPVLRFAPHRPKVLFYCHFP---DQLLS---------------SREGLLKRLYRLPINWLEEH 154
            ..:|:.::. ...:|..|.|:|   ..:||               ||..||.:. :|...:|...
Mouse   180 FTLPLFKYV-GGCRVGSYVHYPTISTDMLSVVKNQNPGFNNAAFISRNALLSKA-KLIYYYLFAF 242

  Fly   155 TIGL----ADKVLVNSKFTLRVFQDTFRRLSTVPDVLYPSLHTQYFDQMQKKLEQRSALLDEPVH 215
            ..||    :|.|:|||.:||......: ::....:::||....|.|             ||.|:|
Mouse   243 VYGLVGSCSDIVMVNSSWTLNHILSLW-KVGHCTNIVYPPCDVQTF-------------LDIPLH 293

  Fly   216 PRVPLNAFIYLDINRYERKKNHALALHSLRLLGDMLPATDFKRCRLIIAGGYDTRCMENVEHFA- 279
            .:......:.:.|.::..:|||||.:.:...|.:...|......:|::.||    |....:.|. 
Mouse   294 EKKVTPGHLLVSIGQFRPEKNHALQIKAFAKLLNEKAAELGHSLKLVLIGG----CRNKDDEFRV 354

  Fly   280 -ELEHLTEELKLQDHVVLLRSPTDEEKCRLLFAAHCLLYTPENEHFGIVPLEGMYCSKPVVALNS 343
             :|..|:|.|.:|::|....:.:.:|....|..|...|:|..||||||..:|.|.....::|.||
Mouse   355 NQLRSLSENLGVQENVEFKINISFDELKNYLSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNS 419

  Fly   344 GGPTETVV----STSTGFLCEKTEKSFGGAM---LQLFRDEQLRVKMGDQGHKRVQQKFSFQAFA 401
            |||...:|    ...||||.| :|:.:..:|   |.|..:|:|::        |...:.|...|:
Mouse   420 GGPKLDIVIPHEGQITGFLAE-SEEGYADSMAHILSLSAEERLQI--------RKNARASISRFS 475

  Fly   402 DR 403
            |:
Mouse   476 DQ 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg2NP_647772.1 RfaB 1..412 CDD:223515 112/458 (24%)
GT1_ALG2_like 2..404 CDD:99977 112/458 (24%)
Alg11NP_001230090.1 PLN02949 64..492 CDD:215511 112/458 (24%)
GT1_ALG11_like 64..480 CDD:99978 112/458 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.