DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg2 and bus-8

Sequence 1:NP_647772.1 Gene:Alg2 FlyBaseID:FBgn0035401 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_508932.1 Gene:bus-8 WormBaseID:WBGene00044623 Length:437 Species:Caenorhabditis elegans

Alignment Length:444 Identity:117/445 (26%)
Similarity:196/445 (44%) Gaps:68/445 (15%)


  Fly     2 VRVLFLHPDLGIGGAERLVVDAALALKERGHQVSFLTNHHD---STHCFK--ETADGTFPVHVVG 61
            :.|:.:||:...||::|..|........:||:|::||...|   ..|.|.  |..:....:| .|
 Worm     1 MHVVIVHPEQWNGGSDRCTVALIRHFVSQGHRVTWLTTMIDEYWKNHTFDGVEIREVGLKLH-PG 64

  Fly    62 DWLPRGLFGRFYAICAYLRMLYAAIYASFFMPQREQVDVVVCDLISVCIPVLRFAPHRPKVLFYC 126
            ||..:.:...::.:.:.|                 ..||.:.|..:.|:|::::...:.|:||||
 Worm    65 DWWSQNVALGWHMVFSNL-----------------NPDVAIIDHSASCVPMIKWRFPQCKILFYC 112

  Fly   127 HFPDQLLSSREGLLKRLYRLPINWLEEHTIGLADKVLVNSKFTLRVFQDTFRRLSTVPD------ 185
            |||.||::.....|.|.|...|..:||...|..|::.|||.||...|      ...:|:      
 Worm   113 HFPQQLVTPSRFFLYRWYAKLIGIVEEELFGHIDQIFVNSNFTATQF------CKVMPNIEKNKV 171

  Fly   186 -VLYPSLHTQYFDQMQKKLEQRSALLDEPVHPRVPLNAFIYLDINRYERKKNHALALHSLRLLGD 249
             |:||.....:.....::...|:        .|.....:.:|.:||:..:|...:.:.:..:|  
 Worm   172 RVVYPPCDIDWIVSASERPVSRA--------QRAKNETYTFLSMNRFWPEKRLDIIIEAASIL-- 226

  Fly   250 MLPATDFKR----CRLIIAGGYDTRCMENVEHFAELEHLTEELKLQDHVVLLRSPTDEEKCRLLF 310
                   |:    ..:.:||.......|:..::..|:.:||||.:.|.|..:.||||:.|.:|..
 Worm   227 -------KQKGYHFHVQLAGSVMPHIPESRIYYEVLQRMTEELNVTDMVTFIPSPTDKVKFQLYQ 284

  Fly   311 AAHCLLYTPENEHFGIVPLEGMYCSKPVVALNSGGPTETVVSTSTGFLCEKTEKSFG----GAML 371
            .....||||.||||||||:|.:...:||:..:||||.|||:...||   .|..|..|    .|||
 Worm   285 QCDTALYTPPNEHFGIVPIEALDQRRPVIVCDSGGPAETVLEDITG---TKIAKPCGELLAEAML 346

  Fly   372 QLFRDEQLRVKMGDQGH----KRVQQKFSFQAFADRLNGIIRDLVPISRESSAK 421
            .............|:|:    .|::.:||.:.|...::..|.:::.....||::
 Worm   347 HHMNKRDWPELDTDEGYAKQRHRLETEFSTRGFCGNIDRAIAEMMGTLEISSSE 400

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg2NP_647772.1 RfaB 1..412 CDD:223515 115/434 (26%)
GT1_ALG2_like 2..404 CDD:99977 114/426 (27%)
bus-8NP_508932.1 RfaB 1..392 CDD:223515 115/435 (26%)
GT1_ALG2_like 1..383 CDD:99977 114/426 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1110
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1339573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45918
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.