DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg2 and gys1

Sequence 1:NP_647772.1 Gene:Alg2 FlyBaseID:FBgn0035401 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_002939278.2 Gene:gys1 XenbaseID:XB-GENE-974345 Length:736 Species:Xenopus tropicalis

Alignment Length:196 Identity:35/197 (18%)
Similarity:64/197 (32%) Gaps:48/197 (24%)


  Fly   230 RYERKKNHALALHSLRLLGDMLPATDFKRCRLIIAG----GYDTRCMEN------------VEHF 278
            ::.:|...:|.:.:|..:..||...||...:..|..    .:...|..|            :...
 Frog   399 KFGKKLYESLLVGNLPDMNKMLDKEDFTMLKRAIFATQRHSFPPICTHNMLDDSTDAILNTIRRI 463

  Fly   279 AELEHLTEELKLQDHVVLLRS-----PTDEEKCRLLFAAHCLLYTPENEHFGIVPLEGMYCSKPV 338
            ......::.:|:..|...|.|     |.|.|:  .:...|..::....|.:|..|.|......|.
 Frog   464 GLFNSSSDRVKVIFHPEFLSSTNPLLPMDNEE--FVRGCHLGVFPSYYEPWGYTPAECTVMGIPS 526

  Fly   339 VALNSGG-----------PT--------------ETVVSTSTGFLCEKTEKSFGGAMLQLFRDEQ 378
            |:.|..|           ||              :...:..|.||...::::....::|..|.|:
 Frog   527 VSTNLSGFGCFMEEHIADPTAYGIYIQDRRFRSVDESCTQLTSFLYSFSQQTRRQRIIQRNRTER 591

  Fly   379 L 379
            |
 Frog   592 L 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg2NP_647772.1 RfaB 1..412 CDD:223515 35/197 (18%)
GT1_ALG2_like 2..404 CDD:99977 35/197 (18%)
gys1XP_002939278.2 GT1_Glycogen_synthase_GSY2_like 26..615 CDD:99967 35/197 (18%)
Glycogen_syn 31..657 CDD:283373 35/197 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.