DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg2 and piga

Sequence 1:NP_647772.1 Gene:Alg2 FlyBaseID:FBgn0035401 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_002942607.2 Gene:piga XenbaseID:XB-GENE-996765 Length:492 Species:Xenopus tropicalis

Alignment Length:455 Identity:93/456 (20%)
Similarity:164/456 (36%) Gaps:134/456 (29%)


  Fly     6 FLHPDLGIGGAERLVVDAALALKERGHQVSFLTNHHDSTHCFKETADGTFPVHVVGD-----WLP 65
            |.:|:  :||.|..:...:..|.||||:|..:|                   |..||     :|.
 Frog    35 FFYPN--VGGVESHIYQLSQCLIERGHKVIIVT-------------------HAYGDRKGIRYLT 78

  Fly    66 RGLFGRFYAICAYLRMLYAAIYASFFMPQREQVDVVVCDLISVCIPVLRFAPHRPKV-LFYCHFP 129
            .||                   ..:::|.:...:......:...:|:|||...|.:| :.:.|..
 Frog    79 NGL-------------------KVYYLPLKVMYNQSTATTLLHSLPLLRFIFVRERVSVIHSHSS 124

  Fly   130 ------DQLLSSREGLLKRLYRLPINWLEEHTI-GLAD--KVLVNSKFTLRVF------------ 173
                  |.|..::...|..::       .:|:: |.||  .||.|...|:.:.            
 Frog   125 FSAMAHDALFHAKTMGLHTVF-------TDHSLFGFADVSSVLTNKLLTVSLCDTNHIICVSYTS 182

  Fly   174 -QDTFRR-------LSTVPDVLYPSLHTQYFDQMQKKLEQRSALLDEPVHPRVPLNAFIYLDINR 230
             ::|..|       :|.:|:.:.|:..|.     ..|:..||.:      ..|.::..:|     
 Frog   183 KENTVLRAALNPEIVSVIPNAIDPTDFTP-----DPKIRDRSRI------TVVVVSRLVY----- 231

  Fly   231 YERKKNHALALHSLRLLGDMLP--ATDFKRCRLIIAGGYDTRCMENVEHFAELEHLTEELKLQDH 293
              ||        .:.|||.::|  ...:.....||.|....|.:        ||.:.|..:|.|.
 Frog   232 --RK--------GIDLLGGIIPEMCQRYPNLHFIIGGEGPKRII--------LEEVRERYQLHDR 278

  Fly   294 VVLLRSPTDEEKCRLLFAAHCLLYTPENEHFGIVPLEGMYCSKPVVALNSGGPTETVVSTSTGFL 358
            |.||.:...::...:|......|.|...|.|.:..:||..|...||:...||..| |:..:...|
 Frog   279 VRLLGALEHQQVRNVLVQGDIFLNTSLTEAFCMAIVEGASCGLQVVSTRVGGIPE-VLPENFIIL 342

  Fly   359 CEKTEKSFGGAMLQLFRDEQLRVKMG-----DQGHKRVQQKFSFQAFADR------LNGIIRDLV 412
            |:.:.||....:.|...    |:..|     :..|:.|...::::..|:|      .|.:.:::|
 Frog   343 CKPSVKSLCSGLEQAIN----RLLAGELLSPETIHRTVSTFYTWRDVAERTEKVCVYNRVAQEVV 403

  Fly   413  412
             Frog   404  403

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg2NP_647772.1 RfaB 1..412 CDD:223515 92/454 (20%)
GT1_ALG2_like 2..404 CDD:99977 91/446 (20%)
pigaXP_002942607.2 GT1_PIG-A_like 28..429 CDD:99970 93/456 (20%)
RfaB 29..401 CDD:223515 92/452 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.