DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cht7 and Chit1

Sequence 1:NP_647768.3 Gene:Cht7 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_001271454.1 Gene:Chit1 MGIID:1919134 Length:464 Species:Mus musculus

Alignment Length:377 Identity:190/378 (50%)
Similarity:245/378 (65%) Gaps:25/378 (7%)


  Fly   124 KIVCYYTNWSQYRVKIGKFVPEDIPADLCTHIIFAFGWLKKNKLSSYESNDETKDNVPGLYERMM 188
            |:|||.|||||||.:..:|.|.|:..:||||:||||..:..::||:.|.|||.      ||:.:.
Mouse    23 KLVCYLTNWSQYRTEAVRFFPRDVDPNLCTHVIFAFAGMDNHQLSTVEHNDEL------LYQELN 81

  Fly   189 TLKKANPKLKILLALGGWSFGTQKFKDMSSTRYTRQTFVYSAIPFLRKRGFDGLDMDWEYPKG-- 251
            :||..|||||.|||:|||:||||||.||.:|...|||||.||:.|||.:||||||:|||:|.|  
Mouse    82 SLKTKNPKLKTLLAVGGWTFGTQKFTDMVATASNRQTFVKSALSFLRTQGFDGLDLDWEFPGGRG 146

  Fly   252 --SDDKKNFVLLLKELREAFEAEAQELKKPRLLLSAAVPVGPDNIRGGYDVPAIASYLDFINLMA 314
              :.||:.|..|:::|.:||:.|||...|.||||:||||.....:..||:|..||..||||||||
Mouse   147 SPTVDKERFTALIQDLAKAFQEEAQSSGKERLLLTAAVPSDRGLVDAGYEVDKIAQSLDFINLMA 211

  Fly   315 YDFHGKWERETGHNAPLYAPSTDSEWRKQLSVDNAASLWVKMGAPKEKLVIGMPTYGRSFTLANP 379
            ||||...|:.||||:|||....:|....:.:||.|.:||::.|.|..||::||||||||||||:.
Mouse   212 YDFHSSLEKTTGHNSPLYKRQGESGAAAEQNVDAAVTLWLQKGTPASKLILGMPTYGRSFTLASS 276

  Fly   380 DKHGPNAPASGGGREGVYTKEGGFLAYYEICEMLLNGAVYVWD-----DEMKVPYLVDGDQWVGF 439
            ..:|..|||:|.|..|.|||:.|.|||||.|.         |.     ::.||||....:|||.|
Mouse   277 SDNGVGAPATGPGAPGPYTKDKGVLAYYEACS---------WKERHRIEDQKVPYAFQDNQWVSF 332

  Fly   440 DDERAIRNKMHWIKSNGFGGAMVWTIDMDDFKGEVCGGNVKYPLIGAMREEL 491
            ||..:.:.|..::|..|.||||||.:|:|||||..|... .||||..:|:||
Mouse   333 DDVESFKAKAAYLKQKGLGGAMVWVLDLDDFKGSFCNQG-PYPLIRTLRQEL 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 177/353 (50%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 188/375 (50%)
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884
Chit1NP_001271454.1 Glyco_18 23..361 CDD:214753 177/353 (50%)
GH18_chitolectin_chitotriosidase 24..383 CDD:119351 188/375 (50%)
Chitooligosaccharide binding. {ECO:0000250} 70..71 1/1 (100%)
Chitooligosaccharide binding. {ECO:0000250} 97..100 3/3 (100%)
Chitooligosaccharide binding. {ECO:0000250} 210..213 3/3 (100%)
CBM_14 418..464 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66610213
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H68318
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264489at33208
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11177
Phylome 1 0.910 0.727 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2066
TreeFam 1 0.960
98.840

Return to query results.
Submit another query.