DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and Chit1

DIOPT Version :10

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_082255.1 Gene:Chit1 / 71884 MGIID:1919134 Length:464 Species:Mus musculus


Alignment Length:82 Identity:18/82 - (21%)
Similarity:27/82 - (32%) Gaps:19/82 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 QSMITPLLITSCFVFCLHVPLCWLLVYKSGLGNLGGALALSFSNCLYTIILGSLMCFSSACSETR 246
            |..:|.::...|  |||            |:.:..|.     ||...|:..|..:.......|..
Mouse    50 QLTVTKVIFVCC--FCL------------GVESFEGG-----SNHTITVKPGGSVTIPCYYDEKN 95

  Fly   247 APLSMEIFDGIGEFFRY 263
            .|.....:..|||..:|
Mouse    96 PPQKKYWYSVIGESRKY 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 GH18_chitolectin_chitotriosidase 125..491 CDD:119351 18/82 (22%)
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:426342
Chit1NP_082255.1 GH18_chitolectin_chitotriosidase 24..383 CDD:119351 18/82 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..416
ChtBD2 416..464 CDD:214696
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.