DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cht7 and chia.3

Sequence 1:NP_647768.3 Gene:Cht7 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_998378.1 Gene:chia.3 ZFINID:ZDB-GENE-040426-2891 Length:471 Species:Danio rerio

Alignment Length:460 Identity:191/461 (41%)
Similarity:267/461 (58%) Gaps:29/461 (6%)


  Fly   559 QVFCYLTSWSAKRPGAGKFQPENIDPKLCTHIVYAFATL-QDYKLTEATDDDPENYESVIALRDN 622
            ::.||.|:||..|||.||:.|.|:||.||||::|||:.: |..:|.....:|...|::...|::.
Zfish    22 EMACYFTNWSQYRPGIGKYTPANVDPYLCTHLIYAFSIINQRNELVTYEWNDETLYKAFNELKNK 86

  Fly   623 NPDLQILLAIGGWAFGSTPFKELTSNVFRMNQFVYEAIDFLRDYKFNGLDVDWEYP--RGA--ED 683
            ||.|:.|||:|||.|||..|..:.||......|:...|.|||.:.|:|||:|||||  ||:  ||
Zfish    87 NPTLKTLLAVGGWNFGSAQFSIMVSNPANRKTFIQSTIKFLRTHGFDGLDLDWEYPGARGSPPED 151

  Fly   684 RVAYVSLLKELRVAFEGEAKSSGLPRLLLTAAVPASFEAIAAGYDVPEISKYLDFINVMTYDFHG 748
            :..:..|.|||..|:|.|:|::|.|:|:|||||.|....|..||::.||:|||:|||||||||||
Zfish   152 KQRFTLLCKELVAAYEAESKATGNPQLMLTAAVSAGKGTIDDGYEIAEIAKYLNFINVMTYDFHG 216

  Fly   749 QWERTVGHNSPLFALESATGYQKKLTVDYSAREWVKQGAPKEKLLIGMPTYGRSFELV-NDTQFD 812
            .|||..||||||:......|.......||:.|.|...|.|.|||.:|...|||:|.|. :||  .
Zfish   217 TWERFTGHNSPLYQGSKDEGDLIYFNTDYAMRYWRDNGTPVEKLRMGFAAYGRTFRLTSSDT--S 279

  Fly   813 IGSPSSGGGKAGKFTNEAGFLSYYEVCSFLAADNTTLVWDSEQQVPFAYRGNQWVGFDDERSLKT 877
            :|:|:||...||.:|.||||.||||:|.||  :.||:.|..:|:||:|.:.::|||||.:.|.:|
Zfish   280 VGAPASGPASAGTYTREAGFWSYYEICGFL--EGTTIQWIDDQKVPYATKNSEWVGFDTKESYET 342

  Fly   878 KTEWLKEQGFGGIMVWSIDMDDFSGR-CGSGKYPLLTALNDELKDYKVELEYDGPYESHGPRGAY 941
            |..:||::.|||..||::|:|||:|: |..|.:||:..|.:.|     ::|......:..|:...
Zfish   343 KVRYLKDKNFGGAFVWALDLDDFAGQFCSQGNHPLMAHLRNLL-----DIELPPMPSTTTPKPGQ 402

  Fly   942 TTKDPHDVT-----------CAEEDGHISYHKDWADCTHYYMCEGERKHHMPCPANLVFNPQENV 995
            :|..|...|           |..:...:..|.:  |...||.|.|.......|....||:.....
Zfish   403 STTRPTTTTTTTTHAPGPGFCNGKPDGLYAHPN--DPNKYYSCAGGHTFVEKCAVGTVFDDSCKC 465

  Fly   996 CDWPE 1000
            |.||:
Zfish   466 CVWPK 470

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753
GH18_chitolectin_chitotriosidase 125..491 CDD:119351
Glyco_18 559..898 CDD:214753 163/345 (47%)
GH18_chitolectin_chitotriosidase 560..919 CDD:119351 172/366 (47%)
CBM_14 951..1005 CDD:279884 13/51 (25%)
chia.3NP_998378.1 Glyco_18 24..363 CDD:214753 163/343 (48%)
GH18_chitolectin_chitotriosidase 25..385 CDD:119351 172/364 (47%)
ChtBD2 421..469 CDD:214696 12/50 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264489at33208
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 1 1.000 T128823
orthoMCL 1 0.900 OOG5_126929
Panther 1 1.100 LDO PTHR11177
Phylome 1 0.910 0.727 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2066
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.