DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cht7 and Cht12

Sequence 1:NP_647768.3 Gene:Cht7 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_726022.1 Gene:Cht12 FlyBaseID:FBgn0050293 Length:470 Species:Drosophila melanogaster

Alignment Length:451 Identity:129/452 (29%)
Similarity:219/452 (48%) Gaps:54/452 (12%)


  Fly   560 VFCYLTSWSAKRPGAGKFQPENIDPKLCTHIVYAFATLQDYKLTE--ATDD----DPENYESVIA 618
            |||.....|....|..:|...::|.:||||:|.......|....|  .||.    :.:...||..
  Fly    25 VFCQYDLGSYYYKGRSQFFEWHLDSRLCTHLVLGSGIGVDGDSGELRITDKILLLEKDKLSSVKT 89

  Fly   619 LRDNNPDLQILLAIGGWAFGSTPFKELTSNVFRMNQFVYEAIDFLRDYKFNGLDVDWEYPR---- 679
            ::.::.. :::..||||...|:.|..:.::..:.:.|....::|:..:.|:|:.:||.||.    
  Fly    90 MKWDSIK-KVMFTIGGWEEDSSSFSRMVASPKKRDNFYSSMLEFMFRWGFDGVQIDWRYPTLLGG 153

  Fly   680 GAEDRVAYVSLLKELRVAFEGEAKSSGLPRLLLTAAVPASFEAIAAGYDVPEISKYLDFINVMTY 744
            ..:||..:|.||:||.:.|    :.:.|  :|:.|.:......|...|::|||..:.|||::|.:
  Fly   154 HPDDRQNFVILLEELGLIF----RKNQL--ILMVAVLGRRDNRILESYNIPEIVNHSDFIHLMMH 212

  Fly   745 DFHGQWERTVGHNSPLFALESATGYQKKLTVDYSAREWVKQGAPKEKLLIGMPTYGRSFELVNDT 809
            |....:...:.:|:||      .||:..:|  .|...|.:.|...|||::|:|.:.|||.: :..
  Fly   213 DEQDPYHLRLAYNAPL------VGYEGSVT--DSIMHWKRNGGAPEKLILGIPLFVRSFTM-DRN 268

  Fly   810 QFDIGSPSSGGGKAGKFTNEAGFLSYYEVCSFLAADNTTLVWDSEQQVPFAYRGNQWVGFDDERS 874
            |..:||...|.|:..|.::..||::|.|.|  :.....:.::|...:||:|.||:|||.:::.||
  Fly   269 QSTVGSACKGPGRQTKQSHRPGFMTYNEWC--VQQSKWSRMFDQLAKVPYATRGDQWVSYENPRS 331

  Fly   875 LKTKTEWLKEQGFGGIMVWSIDMDDFSGRCGSGKYPLLTALNDELKDYKVELEYDGPYESHGPRG 939
            :..|...|:|...||.|.|:||:|||.||||. ::.||..:                :.:.|.:.
  Fly   332 IWAKMHLLQEHKLGGAMAWTIDVDDFRGRCGE-QHGLLRVI----------------FSALGDKN 379

  Fly   940 AYTTKDPHDVTCAEEDG---HISYHKDWADCTHYYMC-EGERKHHMPCPANLVFNPQENVC 996
            ..||:.|    ..|..|   |..:.:|..||..|:.| :|||.:: .|.....|:..:.||
  Fly   380 GLTTEKP----TTEASGLCPHDGFSRDGWDCRLYHECRDGERIYY-ECLEGQYFDENQIVC 435

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753
GH18_chitolectin_chitotriosidase 125..491 CDD:119351
Glyco_18 559..898 CDD:214753 101/348 (29%)
GH18_chitolectin_chitotriosidase 560..919 CDD:119351 110/369 (30%)
CBM_14 951..1005 CDD:279884 15/51 (29%)
Cht12NP_726022.1 GH18_chitinase-like 25..375 CDD:299167 110/385 (29%)
Glyco_hydro_18 47..355 CDD:279094 95/326 (29%)
ChtBD2 394..438 CDD:214696 13/44 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66594739
eggNOG 1 0.900 E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264489at33208
OrthoFinder 1 1.000 FOG0000103
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11177
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.