DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cht7 and chil-9

Sequence 1:NP_647768.3 Gene:Cht7 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_496122.2 Gene:chil-9 WormBaseID:WBGene00014162 Length:460 Species:Caenorhabditis elegans

Alignment Length:526 Identity:116/527 (22%)
Similarity:213/527 (40%) Gaps:150/527 (28%)


  Fly     6 LLRIAFVICLLIVLLSPSADSAQTKTRRRLRRPTTSVSSSRSNLIESKKSTEAPEAEKRIDQITS 70
            |.:...::..::||.:|.|.|. ::.....|..:.:||:....||.|.|::.           |:
 Worm    32 LAKPCLILIAILVLSAPVAYSL-SELIMVARHKSPAVSNLIELLIPSSKTSR-----------TT 84

  Fly    71 ATTTSARRTRL--RSKAKLGAAAAGGAAVAAGGTALVASGSSLKGKKTKVDDGTPKIVCYYTNW- 132
            ..|..:..|:|  :|.......||                  ..||         :||.|:..: 
 Worm    85 TKTNDSTMTKLVQKSDENFSPPAA------------------FCGK---------RIVGYFAEFE 122

  Fly   133 ------SQYRVKIGKFVPEDIPADLCTHIIFAFGWLKKNKL-----SSYESNDETKDNVPGLYER 186
                  .|.|              :.|||:|.|.:.|...:     ||.:..:|.:.||      
 Worm   123 NTALTRKQLR--------------MLTHIVFLFAFPKNGTITFGGESSSQKFEEMRRNV------ 167

  Fly   187 MMTLKKANPKLKILLALGGWSFGTQKFKDMSSTRYTRQTFVYSAIPFLRKRGFDGLDMDWEYPKG 251
                :||:..||:::::|| .:.:.:|..:.|...:|..||.|...|:|....||:|:.|.:||.
 Worm   168 ----RKASSTLKVMISIGG-QYNSGEFSGLVSNETSRNLFVNSIATFVRDYDIDGVDIFWTWPKH 227

  Fly   252 SDDKKNFVLLLKELREAF-EAEAQELKKPRLLLSAAVPVGPDNIRGGYDVPAIASYLDFINLMAY 315
            ||: .|:::.::|||.|| |.:.:..:|...::|..:   ..|:.....:...::::||||:  |
 Worm   228 SDE-NNYLMFIRELRYAFTELQKKLNRKETFVISLVI---SRNVNHLSKLVEFSNFVDFINI--Y 286

  Fly   316 DFHGKWERETGHNAPLYAPSTDSEWRKQLSVDNAASLWV-KMGAP-KEKLVIGM-PTYGRSFTLA 377
            .|: .:..:.|.::|||...:       .:||.....:: |.|.| |..:::.. .||.....|.
 Worm   287 SFN-SYLYQVGPDSPLYGGGS-------RNVDEIMKYYICKTGQPSKFNIIVSFHATYWEGAELP 343

  Fly   378 NPDKHGPNAPASGGGREGVY----TKEGGFLAYYEICEML-------------LNGAVYVWDDEM 425
            ..|           ..:.::    :.:|||...:.  |:|             |....|:|    
 Worm   344 LRD-----------DSDDIFKDQNSAKGGFAVRWR--ELLQQKWDMSNIKFHNLTKTSYMW---- 391

  Fly   426 KVPYLVDG--DQWVGFDDERAIRNKMHWIKSNGFGGAMVWTIDMDD---------FKGEVCGGN- 478
                 :.|  .:::..:||:::|.|..::..:..||..:||||.||         ...|:|.|: 
 Worm   392 -----IPGPPTRFMTLEDEKSLREKNRYVADHNIGGITMWTIDQDDGDHTLLKVVSSAELCTGDR 451

  Fly   479 ---VKY 481
               :||
 Worm   452 RNEIKY 457

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 87/379 (23%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 94/406 (23%)
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884
chil-9NP_496122.2 Glyco_18 113..431 CDD:214753 87/379 (23%)
GH18_chitinase-like 114..431 CDD:299167 87/378 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.