DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16753 and Fam207a

DIOPT Version :8

Sequence 1:NP_647764.1 Gene:CG16753 / 38365 FlyBaseID:FBgn0035393 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001008308.1 Gene:Fam207a / 294333 RGDID:1311257 Length:219 Species:Rattus norvegicus

Alignment Length:143 Identity:42/144 (29%)
Similarity:71/144 (49%) Gaps:19/144 (13%)


  Fly    36 LHKTLTPKKTTTKKEKSEAKHKKLLKRFAEARK---KRKEEHKNREKTKVVGDLKPLRDALPSLQ 97
            |.:...||....||||.:.:.::.|::. ||.|   ::..|.:.|..|.|||||.|||||||.||
  Rat    80 LKRGAEPKAIVPKKEKLKLRRERWLQKI-EAIKLADQKLREERRRRATVVVGDLHPLRDALPELQ 143

  Fly    98 DIYKLVKTKQKDVSEGAALTEPEVRLS------ANEKIRKKRTEMVNTVKSFEKLIKDKNFKKNP 156
            :: :..:.:|:....|.:...| |.||      ..:.:.::||.       |:||:....::.:|
  Rat   144 EL-EAGRQQQQPRRRGTSKPRP-VELSRMSTAQRQQLLEEERTR-------FQKLLASPAYRASP 199

  Fly   157 REVIAAHVRNKYQ 169
            ...|...:.::.|
  Rat   200 LLAIGQQLAHQMQ 212

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16753NP_647764.1 SLX9 54..167 CDD:291986 34/122 (28%)
Fam207aNP_001008308.1 SLX9 87..210 CDD:291986 39/133 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5297
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007970
OrthoInspector 1 1.000 T1088889
orthoMCL 1 0.900 OOG5_135677
Panther 1 1.100 LDO PTHR31109
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
66.010

Return to query results.
Submit another query.