DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16753 and Fam207a

DIOPT Version :8

Sequence 1:NP_647764.1 Gene:CG16753 / 38365 FlyBaseID:FBgn0035393 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_598759.1 Gene:Fam207a / 108707 MGIID:1916334 Length:219 Species:Mus musculus

Alignment Length:139 Identity:41/140 (29%)
Similarity:72/140 (51%) Gaps:11/140 (8%)


  Fly    36 LHKTLTPKKTTTKKEKSEAKHKKLLKRFAE---ARKKRKEEHKNREKTKVVGDLKPLRDALPSLQ 97
            |.:...||....||||.:.:.::.|::...   |.:|.:||.| |:...|||||.|||||||.||
Mouse    80 LKRGAEPKAILPKKEKLKLRRERWLQKIEAIKLAEQKLREERK-RKAMVVVGDLHPLRDALPELQ 143

  Fly    98 DIYKLVKTKQKDVSEGAALTEPE-VRLSANEKIRKKRTEMVNTVKS-FEKLIKDKNFKKNPREVI 160
            :   |...:|:..:.....::|. |.||....:  :|.:::...:: |:||:....::.:|...|
Mouse   144 E---LEAGRQRQQARRRVTSKPRPVELSRMTTV--QRQQLLEEERTRFQKLLASPTYRASPLLAI 203

  Fly   161 AAHVRNKYQ 169
            ...:.::.|
Mouse   204 GQQLAHQMQ 212

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16753NP_647764.1 SLX9 54..167 CDD:291986 33/118 (28%)
Fam207aNP_598759.1 SLX9 87..210 CDD:291986 38/129 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007970
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_135677
Panther 1 1.100 LDO PTHR31109
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R10237
TreeFam 1 0.960
54.990

Return to query results.
Submit another query.