DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1271 and Shpk

Sequence 1:NP_647763.1 Gene:CG1271 FlyBaseID:FBgn0035392 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_083307.1 Gene:Shpk MGIID:1921887 Length:476 Species:Mus musculus

Alignment Length:531 Identity:106/532 (20%)
Similarity:167/532 (31%) Gaps:166/532 (31%)


  Fly    34 LALDVGTTCVRS------------FVLDEQCEVRGSAVDAVELLNPQPGYFEIEPESLWRKIVGV 86
            |.:|:|||.|::            ||:...|.....|.....:..||....::      .:|:..
Mouse     8 LGIDLGTTSVKAALLEAAPSLPSGFVVLASCARAARAETESAVAGPQGREQDV------TRIIQA 66

  Fly    87 ITQ---AVKNAQLTPPDITCLTISTQRCTFLTWDHRSG-EYYH-------------NFITWKDLR 134
            :.:   |:...||  ..:..:.:|.|....|.|....| |:..             :.:||:|.|
Mouse    67 LNECLDALPRQQL--QRVRGIGVSGQMHGILFWKAGQGCEWMEGGPAFVFEPRAVSHLVTWQDGR 129

  Fly   135 ADELVDQWNASWTK-----SSMNWFSYA--LFLLTRQSRFL-----AGS----VLQLMNGQVTPR 183
            .:   ..:.||..|     |....|..|  .:||.....||     ||:    |:.::.|  .||
Mouse   130 CN---SSFLASLPKPDSHLSVATGFGCATIFWLLKNSPEFLKSYDAAGTIQDYVVAMLCG--LPR 189

  Fly   184 LLFEIMNNKKLKQALMQKKARVELLDSWILHKLRTGSSRDKDVEHITDVTSSTATGLYDPFTLSW 248
            .|....|                 ..||                           |.::..:.||
Mouse   190 PLMSDQN-----------------AASW---------------------------GYFNTQSQSW 210

  Fly   249 SPLISWLFGINSKILPRVVDNGYKGFGHVHPTAFGPDWANTEIP----IAASLSDQTAAIWGSQC 309
            :.......|....:||.:.:.|... |....|.|       |||    :..:|.|..|:::  .|
Mouse   211 NLDTLEKAGFPIHLLPDIAEPGSMA-GRTSHTWF-------EIPKGTQVGIALGDLQASVY--SC 265

  Fly   310 FQKNDVKVTMG--TGAFLNLVTGDRCQAVIS-GMYPLVAWQFKKPTRQQG------AVYCIEGAS 365
                     ||  |.|.||:.|..:..|.:. |..||   |...|.....      ..|....||
Mouse   266 ---------MGQRTDAVLNISTSVQLAASMPVGFQPL---QTPDPAAPVAFFPYFDRTYLGVAAS 318

  Fly   366 HDFGTV--------VTWAQSCEL-FDSPANTSDIAQSVPDTNDVFFMPAFSGLGPP------VND 415
            .:.|.|        |.|.....| .:.....|.:.|:.....|.......:.||..      .:.
Mouse   319 LNGGNVLATFVHMLVQWMADLGLEVEESTVYSRMIQAAAQQKDTHLTITPTVLGERHLPDQLASV 383

  Fly   416 YRSASGFIGLTPSTTKAHMVRALLESIVFRLVQLIEAAEKETSQKLHMIRVDGGVSRNDFVCQFL 480
            .|.:|..:.|      .|:.|||...||..|..::...:.:......::.....:|||:.:.|  
Mouse   384 TRISSSDLSL------GHVTRALCRGIVQNLHSMLPFQQLKEWGVARVVGSGSALSRNEVLKQ-- 440

  Fly   481 ADLSRLRVERA 491
                  .|:||
Mouse   441 ------EVQRA 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1271NP_647763.1 GlpK 32..555 CDD:223628 106/532 (20%)
FGGY_GK5_metazoa 32..552 CDD:212665 106/532 (20%)
ShpkNP_083307.1 FGGY_SHK_like 5..466 CDD:212661 106/532 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.