DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1271 and Atad2

Sequence 1:NP_647763.1 Gene:CG1271 FlyBaseID:FBgn0035392 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001128351.1 Gene:Atad2 RGDID:1304849 Length:1373 Species:Rattus norvegicus

Alignment Length:139 Identity:26/140 (19%)
Similarity:51/140 (36%) Gaps:41/140 (29%)


  Fly    88 TQAVKNAQLTPPDITCLTISTQRCTFLTWDHRSGEYYHNFITWKDLRADELVDQWNASWTKSSMN 152
            :|.::.|:.|.|.|.                    |..:...|.::....|    .|::|....|
  Rat   828 SQMIREAKRTAPSIV--------------------YVPHVHLWWEIVGPTL----RATFTTLLQN 868

  Fly   153 WFSYA--LFLLTRQSRFLA-------------GSV--LQLMNGQVTPRLLFEIMNNKKLKQALMQ 200
            ..|:|  |.|.|.:..:.|             |.:  :||.:.:...:...:::..:..|..:.|
  Rat   869 IPSFAPVLLLATSERPYSALPEEVQELFTHDYGEIFNVQLPDKEERTKFFEDLILKQAAKPPVSQ 933

  Fly   201 KKARVELLD 209
            |||.::.|:
  Rat   934 KKAVLQALE 942

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1271NP_647763.1 GlpK 32..555 CDD:223628 26/140 (19%)
FGGY_GK5_metazoa 32..552 CDD:212665 26/140 (19%)
Atad2NP_001128351.1 AAA 444..585 CDD:214640
AAA 449..583 CDD:278434
Bromo_AAA 972..1082 CDD:99957
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.