DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1271 and Atad2

DIOPT Version :10

Sequence 1:NP_647763.1 Gene:CG1271 / 38364 FlyBaseID:FBgn0035392 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001128351.1 Gene:Atad2 / 314993 RGDID:1304849 Length:1373 Species:Rattus norvegicus


Alignment Length:139 Identity:26/139 - (18%)
Similarity:51/139 - (36%) Gaps:41/139 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 TQAVKNAQLTPPDITCLTISTQRCTFLTWDHRSGEYYHNFITWKDLRADELVDQWNASWTKSSMN 152
            :|.::.|:.|.|.|.                    |..:...|.::....|    .|::|....|
  Rat   828 SQMIREAKRTAPSIV--------------------YVPHVHLWWEIVGPTL----RATFTTLLQN 868

  Fly   153 WFSYA--LFLLTRQSRFLA-------------GSV--LQLMNGQVTPRLLFEIMNNKKLKQALMQ 200
            ..|:|  |.|.|.:..:.|             |.:  :||.:.:...:...:::..:..|..:.|
  Rat   869 IPSFAPVLLLATSERPYSALPEEVQELFTHDYGEIFNVQLPDKEERTKFFEDLILKQAAKPPVSQ 933

  Fly   201 KKARVELLD 209
            |||.::.|:
  Rat   934 KKAVLQALE 942

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1271NP_647763.1 ASKHA_NBD_FGGY_GK5-like 32..549 CDD:466803 26/139 (19%)
Atad2NP_001128351.1 RecA-like_Yta7-like 412..581 CDD:410925
AAA_lid_3 609..643 CDD:465537
ycf46 <778..919 CDD:177094 20/114 (18%)
Bromo_AAA 972..1082 CDD:99957
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.