DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1271 and Gk2

Sequence 1:NP_647763.1 Gene:CG1271 FlyBaseID:FBgn0035392 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001004077.1 Gene:Gk2 RGDID:1303263 Length:554 Species:Rattus norvegicus

Alignment Length:550 Identity:153/550 (28%)
Similarity:255/550 (46%) Gaps:53/550 (10%)


  Fly    21 AEESGPPDSPAFILALDVGTTCVRSFVLD-EQCEVRGSAVDAVELLN--PQPGYFEIEPESLWRK 82
            |:....|:.| .:.|:..||...|..|.: :..|:.||  ..|||..  |:.|:.|.:|:.:.:.
  Rat     2 ADSKETPEEP-LVGAVVQGTNSTRFLVFNPKTAELVGS--HQVELTQEYPKEGWVEEDPKEILQS 63

  Fly    83 IVGVIT---QAVKNAQLTPPDITCLTISTQRCTFLTWDHRSGEYYHNFITWKDLRADELVDQWNA 144
            :...|.   :.:..|.:....|..:.:|.||.|.:.||..:||..:|.:.|.|||....|:..|.
  Rat    64 VYECIAKTCEKLTEANIDTSKIKAIGVSNQRETTVVWDKFTGEPLYNAVVWLDLRTQSTVESLNK 128

  Fly   145 SWTKSSMNWFSYALFLLTRQSRFLAGSV-LQLMNGQVTPRLLFEIMNNKKLKQALMQKKARVELL 208
            .               :...|.|:.... |.|.......:|.:.:.|.:.:::|:.:.:|....:
  Rat   129 K---------------IPGNSNFVKSKTGLPLSTYFSAVKLRWMLDNLRPIQKAVEEDRALFGTI 178

  Fly   209 DSWILHKLRTGSSRDKDVEHITDVTSSTATGLYDPFTLSWSPLISWLFGINSKILPRVVDNGYKG 273
            |||::..:..|.:..   .|.||||:::.|.|::..:|.|...:...|.|...|||.|..:. :.
  Rat   179 DSWLIWCMTGGVNGG---IHCTDVTNASRTMLFNIHSLEWDKELCKFFEIPMSILPNVRSSS-EI 239

  Fly   274 FGHVHPTAFGPDWANTEIPIAASLSDQTAAIWGSQCFQKNDVKVTMGTGAFLNLVTGDRCQAVIS 338
            :|.:...|.      ..:||:..|.||:||:.|..|||:...|.|.|||.||...||.:|.....
  Rat   240 YGQMTSGAL------EGVPISGCLGDQSAALVGQMCFQEGQAKNTYGTGCFLLCNTGQKCVFSEH 298

  Fly   339 GMYPLVAWQFKKPTRQQGAVYCIEGASHDFGTVVTWAQ-SCELFDSPANTSDIAQSVPDTNDVFF 402
            |:...||::..|   .:.|.|.:||:....|.|:.|.: :.||..|.....|:|:.|......:|
  Rat   299 GLLTTVAYKLGK---NKPAFYALEGSVAIAGAVIRWLRDNFELITSSGEVEDLAREVGTAYGCYF 360

  Fly   403 MPAFSGLGPPVNDYRSASGFI-GLTPSTTKAHMVRALLESIVFRLVQLIEAAEKETSQKLHMIRV 466
            :||||||..|..: .||.|.| |||..|.|.|:..|.||::.|:..::::|..::....|..:||
  Rat   361 VPAFSGLYAPYWE-PSARGIICGLTQFTNKCHIAFAALEAVCFQTREIVDAMNRDCGIPLSHLRV 424

  Fly   467 DGGVSRNDFVCQFLADLSRLRVERADNAESSIMGATFMAGINLGI--W----RDVNDLKRFRKVA 525
            ||.::.|..:.|..||:..:.|.::...|::.:||...||...||  |    .|::.:...|   
  Rat   425 DGRMTNNKILMQLQADILHIPVVKSVMPETTALGAAMAAGAAEGIDVWSIEPEDLSSMLMER--- 486

  Fly   526 RVFEPRPKEYETIANRMDKWSRTIARFSDW 555
              :||:.:..|: ..|...|.|.:.:...|
  Rat   487 --YEPQIQATES-EIRFSTWKRAVMKSMGW 513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1271NP_647763.1 GlpK 32..555 CDD:223628 149/538 (28%)
FGGY_GK5_metazoa 32..552 CDD:212665 149/535 (28%)
Gk2NP_001004077.1 glycerol_kin 11..513 CDD:273549 150/540 (28%)
FGGY_GK1-3_metazoa 11..513 CDD:212664 150/540 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D352321at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126746
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.