DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1271 and R11F4.1

Sequence 1:NP_647763.1 Gene:CG1271 FlyBaseID:FBgn0035392 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_494721.1 Gene:R11F4.1 WormBaseID:WBGene00020007 Length:502 Species:Caenorhabditis elegans

Alignment Length:545 Identity:143/546 (26%)
Similarity:241/546 (44%) Gaps:70/546 (13%)


  Fly    33 ILALDVGTTCVRSFVLD---------EQCEVRGSAVDAVELLNPQPGYFEIEPESLWRKIVGVIT 88
            :.|:|.||:..|..|.:         .|.|||        .|.|..|:.|::|..|:..:|..|:
 Worm     4 LAAIDQGTSSSRFLVFEADTGELVTSHQIEVR--------QLFPHGGWVEMDPMELYDTVVSCIS 60

  Fly    89 QAV---KNAQLTPPDITCLTISTQRCTFLTWDHRSGEYYHNFITWKDLRADELVDQWNASWTKSS 150
            :.:   :|..::..:|..:.::.||.|.:.||..:|:..:|.|.|.|.|...|.|:..:.....|
 Worm    61 KTIEKLENLGISADEIKSVGVANQRETSIVWDKETGKPLYNAIVWLDTRTSSLADEAISRTASKS 125

  Fly   151 MNWFSYALFLLTRQSRFLAGSVLQLMNGQVTPRLLFEIMNNKKLKQALMQKKARVELLDSWILHK 215
            .:.|           |...|..:......:..:.||:  |..::|:|..........:|:|::.|
 Worm   126 KDEF-----------RAKTGLPIHPYFSALKLKWLFQ--NVPEVKKAYADGNLMFGTVDTWLIWK 177

  Fly   216 LRTGSSRDKDVEHITDVTSSTATGLYDPFTLSWSPLISWLFGINSKILPRVVDNGYKGFGHVHPT 280
            | ||:       ::|||::::.|.|.|.....||..:...|.:..:|||.:..:. :.:||... 
 Worm   178 L-TGA-------YVTDVSNASRTLLLDLHKRKWSTQLCEFFDLPIEILPEIRSSA-EVYGHFDK- 232

  Fly   281 AFGPDWANTEIPIAASLSDQTAAIWGSQCFQKNDVKVTMGTGAFLNLVTGDRCQAVISGMYPLVA 345
              ||   ...:|::..|.||.||:.|.||......|.|.|||.|:....|.|.....:|:...|.
 Worm   233 --GP---LEGVPLSGCLGDQQAAMVGHQCLNAGQTKNTYGTGTFMLCNIGTRPIISKNGLLTTVG 292

  Fly   346 WQFKKPTRQQGA----VYCIEGASHDFGTVVTWAQSCELFDSPANTSD-IAQSVPDTNDVFFMPA 405
            :||       ||    ||.:||:....|.||.:.:....|.|.|...: :.:||.||:..:|:|:
 Worm   293 FQF-------GADSPVVYALEGSGSIGGNVVRFLRDNFKFISDAKEMEGLCRSVEDTSGAYFVPS 350

  Fly   406 FSGLGPPVNDYRSASGFIGLTPSTTKAHMVRALLESIVFRLVQLIEAAEK--ETSQKLHMIRVDG 468
            |:||..|..|..:....:|||..|.:.|:..|.|.::.|:..::|.|.|:  |...|:..::|||
 Worm   351 FTGLYTPYWDSTARGTILGLTQVTQREHICLAALRAVAFQSAEMIAAVEQDLEGGTKVTTLKVDG 415

  Fly   469 GVSRNDFVCQFLADLSRLRVERADNAESSIMGATFMAGINLGIWRDVNDLKRFRKVA---RVFEP 530
            |:..|....:..||:....:......|.|..||. :||   ||......|..|.:.:   ..:.|
 Worm   416 GMIANKLFNEIQADIMGRDIVTPKITEISGWGAA-VAG---GIGAQQISLDEFLQQSSEDNRYTP 476

  Fly   531 RPKEYETIANRMDKWSRTIARFSDW 555
            : |:....:..:.:|...:.|...|
 Worm   477 Q-KDDNWRSAELARWKEAVKRSCGW 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1271NP_647763.1 GlpK 32..555 CDD:223628 142/544 (26%)
FGGY_GK5_metazoa 32..552 CDD:212665 142/541 (26%)
R11F4.1NP_494721.1 glycerol_kin 3..500 CDD:273549 142/544 (26%)
FGGY_GK 3..491 CDD:198347 141/535 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D352321at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126746
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.