DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1271 and Psmc1

Sequence 1:NP_647763.1 Gene:CG1271 FlyBaseID:FBgn0035392 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_476464.1 Gene:Psmc1 RGDID:621097 Length:440 Species:Rattus norvegicus

Alignment Length:243 Identity:43/244 (18%)
Similarity:87/244 (36%) Gaps:85/244 (35%)


  Fly    23 ESGPPDSPAFILALDVGTTCVRSFVLDEQC-EVRGSAVDAVELLNPQPGYFE---IEP------- 76
            |..|.::.|     |:|.       ||.|. |::    ::|||....|.|:|   |:|       
  Rat   177 EKAPQETYA-----DIGG-------LDNQIQEIK----ESVELPLTHPEYYEEMGIKPPKGVILY 225

  Fly    77 ------------------ESLWRKIVG-------------VITQAVKNAQLTPPDITCL----TI 106
                              .:.:.::||             ::.:..:.|:...|.|..:    .|
  Rat   226 GPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAI 290

  Fly   107 STQRCTFLTWDHRSG---EYYHNFITWKDLRADELVDQWNASWTKSSMNWFSYALFLLTRQSRFL 168
            .|:|     :|..||   |.....:        ||::|.:...::..:.     :.:.|.:...|
  Rat   291 GTKR-----YDSNSGGEREIQRTML--------ELLNQLDGFDSRGDVK-----VIMATNRIETL 337

  Fly   169 AGSVLQLMNGQVTPRLLFEIMNNKKLKQALMQKKARVELLDSWILHKL 216
            ..::::  .|::..::.|.:.:.|..|:......:|:.|.|...|..|
  Rat   338 DPALIR--PGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDL 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1271NP_647763.1 GlpK 32..555 CDD:223628 40/235 (17%)
FGGY_GK5_metazoa 32..552 CDD:212665 40/235 (17%)
Psmc1NP_476464.1 PTZ00361 1..440 CDD:185575 43/244 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.