DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2162 and AT5G22120

DIOPT Version :9

Sequence 1:NP_001163332.2 Gene:CG2162 / 38360 FlyBaseID:FBgn0035388 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_680198.1 Gene:AT5G22120 / 832273 AraportID:AT5G22120 Length:383 Species:Arabidopsis thaliana


Alignment Length:369 Identity:93/369 - (25%)
Similarity:150/369 - (40%) Gaps:98/369 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 SGAQRTKPGNGNKSA---------SNGKSQASPPLRIEDVVAARSTNGEEPA-KCDNDVRELQRA 403
            |..:||:.|....:|         |.|.|..|..||      .||:..::.| .||       .|
plant    53 SSGERTEFGLQLSAALTQLADLYSSEGLSLKSDELR------TRSSLIKQRALDCD-------LA 104

  Fly   404 SKEINRSNRRIMKQTFNSDVLEIPEKIETSATKAIPTSPQASATAK---PPVDSTTEDDDEEDED 465
            |   :||:..:..|:           :.:|..|:.|......|..|   ..|.|:.....:..:|
plant   105 S---SRSSGNVENQS-----------VASSGLKSDPNVSSFDADGKTEDSKVSSSNSAAHDSSDD 155

  Fly   466 DWEKMFDESGDCLDPKLLQELTESVGKCKIELPKMD-------YTVFHIKQQLLNEEEFP----- 518
            |||.:.|.....|.|  ::||.| :.|..:|.||:.       .|..:....:.::.:|.     
plant   156 DWEALADVEPSKLLP--VEELPE-ISKLSVEEPKVQGPKRRGRGTFTYKSDAMYSDRDFSESRFD 217

  Fly   519 --------------------------HVLEVSNFPVEFKTPDLLMLFAQYRGSGFDIKWVDDTHA 557
                                      |||.::.|....:|.:|..||..::.|||.|:||:||.|
plant   218 DDSEDNDLSRESEKTDESLKSKYGTRHVLVLAGFSPSLRTTELEKLFKDFKDSGFIIRWVNDTTA 282

  Fly   558 LAVFSSSRIAAEVLTMGHPFVKLKPLAEATLESRLKAKKAGAVS---MQPYRQRPETCTALARRL 619
            ||||.:...|.|..........::.|.:.  :|.|     |::|   ::|..|||:|....|:||
plant   283 LAVFKTPSAALEACKHVQCSFTIRVLDDN--DSLL-----GSISGKDLEPPSQRPKTSAKTAQRL 340

  Fly   620 VSGALGVKLPTA---PQERENERRVLREAKERKLLAAKQRDEVW 660
            ::.::|:|||.:   .:||:.|    ...|.|.:...|||::.|
plant   341 IAHSMGLKLPASGFGSKERDQE----AARKNRIVSRQKQREDAW 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2162NP_001163332.2 R3H 6..70 CDD:294210
RRM_SF 519..583 CDD:302621 23/63 (37%)
AT5G22120NP_680198.1 RRM_SF 243..306 CDD:388407 23/62 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002567
OrthoInspector 1 1.000 - - oto3988
orthoMCL 1 0.900 - - OOG6_106213
Panther 1 1.100 - - LDO PTHR21678
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4368
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.