DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and LOC1277252

DIOPT Version :10

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_061505089.1 Gene:LOC1277252 / 1277252 VectorBaseID:AGAMI1_007534 Length:130 Species:Anopheles gambiae


Alignment Length:49 Identity:13/49 - (26%)
Similarity:22/49 - (44%) Gaps:10/49 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 FLLSLFNWGLALF--QMSVGLGNNSSITMIRMTMYLVAAGYQIVVYCYN 343
            |.|.|....|.|.  ::.:|.|::|..::.|.|...        ::|||
Mosquito    48 FALMLLGTVLLLIVPKIVLGTGSDSFDSIARSTAEF--------IFCYN 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 13/49 (27%)
LOC1277252XP_061505089.1 None

Return to query results.
Submit another query.