DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AhcyL1 and HOG1

Sequence 1:NP_647746.1 Gene:AhcyL1 FlyBaseID:FBgn0035371 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_193130.1 Gene:HOG1 AraportID:AT4G13940 Length:485 Species:Arabidopsis thaliana

Alignment Length:486 Identity:225/487 (46%)
Similarity:308/487 (63%) Gaps:54/487 (11%)


  Fly    85 VQKNSKGSSDFCVRNIGAQHAFGRREIEIAEQEMPGIIALKKRAAEDKPLKDAKIVGCTHINAQT 149
            |:|.|.| .::.|::: :|..|||.|:|:||.||||::|.:......:|.|.|:|.|..|:..||
plant     5 VEKTSSG-REYKVKDM-SQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMTIQT 67

  Fly   150 AVLIETLVELGASVRWAACNIYSTQNEVAAALAESGIPIFAWRGETEEDFWWCIDRCVNAENW-- 212
            |||||||..|||.|||.:|||:|||:..|||:|.....:|||:|||.:::|||.:|   |.:|  
plant    68 AVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER---ALDWGP 129

  Fly   213 --QPNMILDDGGDATHLM-----------------------------------------LKKYPT 234
              .|::|:|||||||.|:                                         .|||..
plant   130 GGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQVDPKKYHK 194

  Fly   235 MFKLVKGIVEESVTGVHRLYQLSKAGKLTVPAMNVNDSVTKTKFDNLYSCKESILDSLKRSTDVM 299
            |.:.:.|:.||:.|||.||||:.:.|.|..||:||||||||:||||||.|:.|:.|.|.|:||||
plant   195 MKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVM 259

  Fly   300 FGGKQVVVCGYGDVGKGCAQALKGQGCIVYITEIDPICALQASMDGFRVVKLNEVIRNVDIVVTA 364
            ..||..|:|||||||||||.|:|..|..|.:|||||||||||.|:|.:|:.|.:|:...||.||.
plant   260 IAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVTT 324

  Fly   365 TGNKNVVVREHMDKMKSGCIVCNMGHSNTEIDVNGLRT-PDLTWEKVRSQVDHIIWPEGKY-IIL 427
            ||||::::.:||.|||:..||||:||.:.|||:.||.| |.:....::.|.|..::||.|. ||:
plant   325 TGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKAGIIV 389

  Fly   428 LAEGRLVNLSCSS-IPSFAVSITSATQALALIELFN-APPGRYKSDVYLLPKKMDEYVASLHLPT 490
            ||||||:||.|:: .|||.:|.:...|.:|.:||:| ...|:|:..||:|||.:||.||.|||..
plant   390 LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVALLHLGK 454

  Fly   491 FDAHLTELSDEQAKYMGLNKAGPFKPNYYRY 521
            ..|.||:||.:|:.|:.:...||:||.:|||
plant   455 LGARLTKLSKDQSDYVSIPIEGPYKPPHYRY 485

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AhcyL1NP_647746.1 AdoHcyase 94..520 CDD:283003 219/475 (46%)
PRK05476 94..515 CDD:235488 216/470 (46%)
HOG1NP_193130.1 PLN02494 9..485 CDD:178111 222/481 (46%)
AdoHcyase 13..484 CDD:283003 219/475 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D371693at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR23420
Phylome 1 0.910 0.639 Consistency score
33.020

Return to query results.
Submit another query.