DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AhcyL1 and Ahcyl2

Sequence 1:NP_647746.1 Gene:AhcyL1 FlyBaseID:FBgn0035371 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_067389.5 Gene:Ahcyl2 MGIID:1921590 Length:613 Species:Mus musculus

Alignment Length:577 Identity:393/578 (68%)
Similarity:441/578 (76%) Gaps:73/578 (13%)


  Fly    12 PGFGGGDKQQQAGPAPQDASVVVPPPA---------------TKQSSALKKT------SRYR--- 52
            |..||||.:   .|||..|:...|.|.               ..|:||:|::      .|:|   
Mouse    43 PPAGGGDPE---APAPAPAAERPPAPGPGSGPTAALSPAAGKVPQASAMKRSDPHHQHQRHRDGG 104

  Fly    53 ------------------------------------------SRSLSASSTDSFSS-ASYTGSSE 74
                                                      |||:|.|||||:|| ||||.||:
Mouse   105 EALVSPDGTVTEAPRTVKKQIQFADQKQEFNKRPTKIGRRSLSRSISQSSTDSYSSAASYTDSSD 169

  Fly    75 DGDDVPPREKVQKNSKGSSDFCVRNIGAQHAFGRREIEIAEQEMPGIIALKKRAAEDKPLKDAKI 139
              |:..||:|.||||||||||||:|| .|..||||||||||||||.::||:|||..:|||..|||
Mouse   170 --DETSPRDKQQKNSKGSSDFCVKNI-KQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKI 231

  Fly   140 VGCTHINAQTAVLIETLVELGASVRWAACNIYSTQNEVAAALAESGIPIFAWRGETEEDFWWCID 204
            ||||||.||||||:|||..|||..||||||||||.|||||||||||.|:|||:||:|:|||||||
Mouse   232 VGCTHITAQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCID 296

  Fly   205 RCVNAENWQPNMILDDGGDATHLMLKKYPTMFKLVKGIVEESVTGVHRLYQLSKAGKLTVPAMNV 269
            ||||.|.||||||||||||.||.:.||||.|||.:|||||||||||||||||||||||.||||||
Mouse   297 RCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNV 361

  Fly   270 NDSVTKTKFDNLYSCKESILDSLKRSTDVMFGGKQVVVCGYGDVGKGCAQALKGQGCIVYITEID 334
            ||||||.||||||.|:|||||.|||:||:|||||||||||||:|||||..|||..|.|||:||||
Mouse   362 NDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEID 426

  Fly   335 PICALQASMDGFRVVKLNEVIRNVDIVVTATGNKNVVVREHMDKMKSGCIVCNMGHSNTEIDVNG 399
            |||||||.|||||:||||||||.||||:|.|||||||.|||:|:||:.|||||||||||||||..
Mouse   427 PICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVAS 491

  Fly   400 LRTPDLTWEKVRSQVDHIIWPEGKYIILLAEGRLVNLSCSSIPSFAVSITSATQALALIELFNAP 464
            ||||:||||:|||||||:|||:||.|:|||||||:|||||::|:|.:|||:.|||||||||:|||
Mouse   492 LRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAP 556

  Fly   465 PGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPNYYRY 521
            .||||.||||||||||||||||||||||||||||:||||||:||||.||||||||||
Mouse   557 EGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 613

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AhcyL1NP_647746.1 AdoHcyase 94..520 CDD:283003 345/426 (81%)
PRK05476 94..515 CDD:235488 340/421 (81%)
Ahcyl2NP_067389.5 LISN domain, inhibits interaction with ITPR1. {ECO:0000250|UniProtKB:Q96HN2} 2..111 17/71 (24%)
AdoHcyase 187..612 CDD:310083 345/426 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C45608837
eggNOG 1 0.900 E1_COG0499
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 773 1.000 Inparanoid score I526
Isobase 1 0.950 0 Normalized mean entropy S495
OMA 1 1.010
OrthoDB 1 1.010 D207688at33208
OrthoFinder 1 1.000 FOG0002342
OrthoInspector 1 1.000 T617048
orthoMCL 1 0.900 OOG5_130931
Panther 1 1.100 O PTHR23420
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5762
TreeFam 1 0.960
1413.750

Return to query results.
Submit another query.