DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AhcyL1 and ahcy

Sequence 1:NP_647746.1 Gene:AhcyL1 FlyBaseID:FBgn0035371 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_954688.1 Gene:ahcy ZFINID:ZDB-GENE-031219-6 Length:433 Species:Danio rerio

Alignment Length:418 Identity:219/419 (52%)
Similarity:303/419 (72%) Gaps:3/419 (1%)


  Fly   106 FGRREIEIAEQEMPGIIALKKRAAEDKPLKDAKIVGCTHINAQTAVLIETLVELGASVRWAACNI 170
            :||:.|||||.||||::.:::...:.||||.|:|.||.|:..|||||||||..|||.|:|::|||
Zfish    17 WGRKAIEIAENEMPGLMKMRELYGQSKPLKGARIAGCLHMTLQTAVLIETLTALGAEVQWSSCNI 81

  Fly   171 YSTQNEVAAALAESGIPIFAWRGETEEDFWWCIDRCVNAENWQP-NMILDDGGDATHLMLKKYPT 234
            :|||:..|||:|::|:|::||:|||:|::.|||::.:..::.|| |||||||||.|:|:.:|||.
Zfish    82 FSTQDHAAAAIAKTGVPVYAWKGETDEEYVWCIEQTIYFKDGQPLNMILDDGGDLTNLVHQKYPK 146

  Fly   235 MFKLVKGIVEESVTGVHRLYQLSKAGKLTVPAMNVNDSVTKTKFDNLYSCKESILDSLKRSTDVM 299
            :...:|||.||:.||||.||::.|:|:|.|||:||||||||:||||||.|:||::|.:||:||||
Zfish   147 LLAGIKGISEETTTGVHNLYKMLKSGELKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVM 211

  Fly   300 FGGKQVVVCGYGDVGKGCAQALKGQGCIVYITEIDPICALQASMDGFRVVKLNEVIRNVDIVVTA 364
            ..||..||.|||||||||.|||:|.|..|.:||||||.||||:|:|:.|..::|..:..:|.||.
Zfish   212 IAGKVAVVAGYGDVGKGCVQALRGFGARVIVTEIDPINALQAAMEGYEVTTMDEACKEGNIFVTT 276

  Fly   365 TGNKNVVVREHMDKMKSGCIVCNMGHSNTEIDVNGLRTPDLTWEKVRSQVDHIIWPEGKYIILLA 429
            ||.:::::..|.:.||...||||:||.:.|||:..|.........::.|||......|::||:||
Zfish   277 TGCEDILLGRHFEHMKDDSIVCNIGHFDCEIDMKWLNEHAAKKINIKPQVDRYRMKNGRHIIVLA 341

  Fly   430 EGRLVNLSCS-SIPSFAVSITSATQALALIELFNAPPGRYKSDVYLLPKKMDEYVASLHLPTFDA 493
            |||||||.|: ..|||.:|.:...|.||.|||:. ...:|...||.||||:||.||:.||.....
Zfish   342 EGRLVNLGCAMGHPSFVMSNSFTNQVLAQIELWK-NNSKYPLGVYFLPKKLDEEVAAAHLDKLGV 405

  Fly   494 HLTELSDEQAKYMGLNKAGPFKPNYYRY 521
            .||:|:::||||:||...|||||::|||
Zfish   406 KLTKLTEKQAKYLGLPSEGPFKPDHYRY 433

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AhcyL1NP_647746.1 AdoHcyase 94..520 CDD:283003 217/416 (52%)
PRK05476 94..515 CDD:235488 214/411 (52%)
ahcyNP_954688.1 PRK05476 1..427 CDD:235488 214/411 (52%)
AdoHcyase 6..432 CDD:283003 217/416 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0499
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D371693at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.