DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AhcyL1 and AHCYL2

Sequence 1:NP_647746.1 Gene:AhcyL1 FlyBaseID:FBgn0035371 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_056143.1 Gene:AHCYL2 HGNCID:22204 Length:611 Species:Homo sapiens

Alignment Length:575 Identity:393/576 (68%)
Similarity:441/576 (77%) Gaps:71/576 (12%)


  Fly    12 PGFGGGDKQQQAGPAPQDASVVVPPPAT-------------KQSSALKKT------SRYR----- 52
            |..||||.:   .|||......||.|.:             .|:||:|::      .|:|     
Human    43 PPAGGGDPE---APAPAAERPPVPGPGSGPAAALSPAAGKVPQASAMKRSDPHHQHQRHRDGGEA 104

  Fly    53 ----------------------------------------SRSLSASSTDSFSS-ASYTGSSEDG 76
                                                    |||:|.|||||:|| ||||.||:  
Human   105 LVSPDGTVTEAPRTVKKQIQFADQKQEFNKRPTKIGRRSLSRSISQSSTDSYSSAASYTDSSD-- 167

  Fly    77 DDVPPREKVQKNSKGSSDFCVRNIGAQHAFGRREIEIAEQEMPGIIALKKRAAEDKPLKDAKIVG 141
            |:..||:|.||||||||||||:|| .|..||||||||||||||.::||:|||..:|||..|||||
Human   168 DETSPRDKQQKNSKGSSDFCVKNI-KQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVG 231

  Fly   142 CTHINAQTAVLIETLVELGASVRWAACNIYSTQNEVAAALAESGIPIFAWRGETEEDFWWCIDRC 206
            ||||.||||||:|||..|||..||||||||||.|||||||||||.|:|||:||:|:|||||||||
Human   232 CTHITAQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRC 296

  Fly   207 VNAENWQPNMILDDGGDATHLMLKKYPTMFKLVKGIVEESVTGVHRLYQLSKAGKLTVPAMNVND 271
            ||.|.||||||||||||.||.:.||||.|||.:|||||||||||||||||||||||.||||||||
Human   297 VNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVND 361

  Fly   272 SVTKTKFDNLYSCKESILDSLKRSTDVMFGGKQVVVCGYGDVGKGCAQALKGQGCIVYITEIDPI 336
            ||||.||||||.|:|||||.|||:||:|||||||||||||:|||||..|||..|.|||:||||||
Human   362 SVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPI 426

  Fly   337 CALQASMDGFRVVKLNEVIRNVDIVVTATGNKNVVVREHMDKMKSGCIVCNMGHSNTEIDVNGLR 401
            |||||.|||||:||||||||.||||:|.|||||||.|||:|:||:.|||||||||||||||..||
Human   427 CALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLR 491

  Fly   402 TPDLTWEKVRSQVDHIIWPEGKYIILLAEGRLVNLSCSSIPSFAVSITSATQALALIELFNAPPG 466
            ||:||||:|||||||:|||:||.|:|||||||:|||||::|:|.:|||:.|||||||||:|||.|
Human   492 TPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEG 556

  Fly   467 RYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPNYYRY 521
            |||.||||||||||||||||||||||||||||:||||||:||||.||||||||||
Human   557 RYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 611

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AhcyL1NP_647746.1 AdoHcyase 94..520 CDD:283003 345/426 (81%)
PRK05476 94..515 CDD:235488 340/421 (81%)
AHCYL2NP_056143.1 LISN domain, inhibits interaction with ITPR1. {ECO:0000269|PubMed:19220705} 2..109 17/69 (25%)
AdoHcyase 185..610 CDD:310083 345/426 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C45610320
eggNOG 1 0.900 E1_COG0499
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 774 1.000 Inparanoid score I525
Isobase 1 0.950 0 Normalized mean entropy S495
OMA 1 1.010
OrthoDB 1 1.010 D207688at33208
OrthoFinder 1 1.000 FOG0002342
OrthoInspector 1 1.000 T610246
orthoMCL 1 0.900 OOG5_130931
Panther 1 1.100 O PTHR23420
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5762
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.750

Return to query results.
Submit another query.