DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AhcyL1 and Gm4737

Sequence 1:NP_647746.1 Gene:AhcyL1 FlyBaseID:FBgn0035371 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001291457.1 Gene:Gm4737 MGIID:3643647 Length:432 Species:Mus musculus

Alignment Length:426 Identity:221/427 (52%)
Similarity:306/427 (72%) Gaps:3/427 (1%)


  Fly    97 VRNIGAQHAFGRREIEIAEQEMPGIIALKKRAAEDKPLKDAKIVGCTHINAQTAVLIETLVELGA 161
            |.:||.. |:||:.::|||.||||::.:::..:..||||.|:|.||.|:..:|||||||||.|||
Mouse     9 VADIGLA-AWGRKALDIAENEMPGLMRMREMYSASKPLKGARIAGCLHMTVETAVLIETLVALGA 72

  Fly   162 SVRWAACNIYSTQNEVAAALAESGIPIFAWRGETEEDFWWCIDRCVNAENWQPNMILDDGGDATH 226
            .|||::|||:|||:..|||:|::|||:|||:|||:|::.|||::.::.::...|||||||||.|:
Mouse    73 EVRWSSCNIFSTQDHAAAAIAKAGIPVFAWKGETDEEYLWCIEQTLHFKDGPLNMILDDGGDLTN 137

  Fly   227 LMLKKYPTMFKLVKGIVEESVTGVHRLYQLSKAGKLTVPAMNVNDSVTKTKFDNLYSCKESILDS 291
            |:..|||.:...::||.||:.||||.||::...|.|.|||:||||||||:||||||.|:||::|.
Mouse   138 LIHTKYPQLLSGIRGISEETTTGVHNLYKMMSNGILKVPAINVNDSVTKSKFDNLYGCRESLIDG 202

  Fly   292 LKRSTDVMFGGKQVVVCGYGDVGKGCAQALKGQGCIVYITEIDPICALQASMDGFRVVKLNEVIR 356
            :||:||||..||..||.|||||||||||||:|.|..|.|||||||.||||:|:|:.|..::|..:
Mouse   203 IKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDEACK 267

  Fly   357 NVDIVVTATGNKNVVVREHMDKMKSGCIVCNMGHSNTEIDVNGLRTPDLTWEKVRSQVDHIIWPE 421
            ..:|.||.||..::::..|.::||...||||:||.:.||||..|....:....::.|||......
Mouse   268 EGNIFVTTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYWLKN 332

  Fly   422 GKYIILLAEGRLVNLSCS-SIPSFAVSITSATQALALIELFNAPPGRYKSDVYLLPKKMDEYVAS 485
            |:.||||||||||||.|: ..|||.:|.:...|.:|.|||: ..|.:|...|:.||||:||.||.
Mouse   333 GRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELW-THPDKYPVGVHFLPKKLDEAVAE 396

  Fly   486 LHLPTFDAHLTELSDEQAKYMGLNKAGPFKPNYYRY 521
            .||...:..||:|:::||:|:|:...|||||::|||
Mouse   397 AHLGKLNVKLTKLTEKQAQYLGMPINGPFKPDHYRY 432

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AhcyL1NP_647746.1 AdoHcyase 94..520 CDD:283003 219/424 (52%)
PRK05476 94..515 CDD:235488 216/419 (52%)
Gm4737NP_001291457.1 AdoHcyase 6..431 CDD:310083 219/424 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0499
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D371693at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.