DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Non2 and smarcd3

Sequence 1:NP_647745.1 Gene:Non2 FlyBaseID:FBgn0035370 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_017945723.1 Gene:smarcd3 XenbaseID:XB-GENE-494884 Length:750 Species:Xenopus tropicalis

Alignment Length:164 Identity:33/165 (20%)
Similarity:55/165 (33%) Gaps:49/165 (30%)


  Fly    86 EEEDPSSSEEEAAKKKKQSPKKRPQPTKHKAPKKK-----------------RKTLNADDSGTES 133
            ::..|:.....:||::|.:.|..||..:...|:.:                 ||.::..      
 Frog    84 QQATPTQGRSRSAKRRKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRIDIQ------ 142

  Fly   134 DAGSDSDYEVVKKPAAKKK------------AKAAGGTGSGRKSTGFTRAYNLSPELSALMGESS 186
                    |.:|:|..:|:            |||     ....|.|...::.|..|...|...|.
 Frog   143 --------EALKRPMKQKRKLRLYISNTFNPAKA-----DADDSDGSIASWELRVEGKLLDDPSK 194

  Fly   187 LPR-HEVVKKVWAIIKERDLYDPKNKQFAICDDE 219
            :.| .....|...|..::|||.|.|....:|..|
 Frog   195 MKRKFSSFFKSLVIELDKDLYGPDNHLVEVCGAE 228

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Non2NP_647745.1 DEK_C 7..57 CDD:285919
SWIB 170..242 CDD:280380 14/52 (27%)
smarcd3XP_017945723.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C105091689
eggNOG 1 0.900 E1_COG5531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000347
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.