DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mrtf and mrtfba

Sequence 1:NP_001137879.3 Gene:Mrtf FlyBaseID:FBgn0052296 Length:1788 Species:Drosophila melanogaster
Sequence 2:XP_009304978.1 Gene:mrtfba ZFINID:ZDB-GENE-130531-36 Length:986 Species:Danio rerio

Alignment Length:1401 Identity:333/1402 (24%)
Similarity:508/1402 (36%) Gaps:517/1402 (37%)


  Fly   262 AACSGLLATRLSGKDLEHSFQDIILLHEAYDDMSEGEQRLHATFLGSSDDGNNSDCYDARQSPPK 326
            ||..||||.         |.|...:.||.      ||..||                        
Zfish     7 AAIGGLLAP---------SPQSEAVTHEM------GELSLH------------------------ 32

  Fly   327 AIVDSSPLQ--PAMDKNKESLKVKLMVRRPHSQLVEQGIIPSLKTSPAIHEQCKQLERAKTSDLL 389
                  |.|  |.:::.|..|:::|..||...|||||||:|.||:..|.|||.:.||||:|.:.|
Zfish    33 ------PSQRLPPLNERKNVLQLRLQQRRTREQLVEQGIMPPLKSPAAFHEQIRSLERARTENFL 91

  Fly   390 KAKIQQRPNREDLERLHILEEDECHIDPSLAEKQRMLKKARLADQLNSQIQHRPGPLELIKKNIL 454
            |.||:.||.|.:|.|:|||:|...  :|||...|..||:|||||.||.:|..||||:||::||||
Zfish    92 KHKIRSRPERAELVRMHILQETLA--EPSLQATQLRLKRARLADDLNEKIAQRPGPMELVEKNIL 154

  Fly   455 HTEKPIEKIVKEGLVSFKATSEGLLTRPQHPHSYVTFDDDSLSSESDTRQTPPRLDEAMVATSSS 519
            ..:..:::.:.:|.:.:..|.|.|:            |:||..:.|..:   |...|:       
Zfish   155 PVDSSLKEAIIDGQMQYPRTLEDLI------------DEDSGDAFSPEQ---PASQES------- 197

  Fly   520 PTDVLQAAAASAGIVTMALTMPTAGQLVVTSPQILPQQQQPKAIVVPAPVPPPPPPPPPLPMASI 584
                 |.:|||                                   ||.|               
Zfish   198 -----QGSAAS-----------------------------------PAEV--------------- 207

  Fly   585 IKVKQETANLYEELCQSVTGTTASPVNHLYSPCSLASSTSTLSPLSSI---ASPPPP-PMTTTRL 645
             :..:||:.|...|.|             :.|....:||..|.|.|::   .|||.| |...|  
Zfish   208 -RTMEETSPLPNNLLQ-------------HFPAVTTTSTDFLKPFSTVEQSVSPPAPIPQLVT-- 256

  Fly   646 HLAPVS-----VKSDAP----GKDKNRKKSKSKPVSKARTIKFHEYKGPPSAAGQKQDQTQ-PEE 700
             :|||.     ||...|    .|.:::|..:|||  :.:.:|:|:|. ||.   |||:..| |.:
Zfish   257 -VAPVKSGPTLVKQSQPKLPGDKSRSKKSKESKP--RVKKLKYHQYI-PPD---QKQEPDQAPMD 314

  Fly   701 TSYQLMLEQQNCLLKFLENLNKN-------QSIIPAPSAPGVMLPAAPGATNNSITVTTKTVPAL 758
            :||..:|:||...|: |:.|::.       |:|:|||..|.:      ...|:|.||....    
Zfish   315 SSYARLLQQQQLFLQ-LQILSQQQQQHYNYQTILPAPLKPVI------EGQNSSATVAINN---- 368

  Fly   759 ASQSAPAPAPISLPNTISITSSSGGAPLNFGDATMLTPTPAATPTPPTLSLIAAPQQQLQLHQQH 823
             :.|.||...:|||.|                                                 
Zfish   369 -ANSLPASIVVSLPTT------------------------------------------------- 383

  Fly   824 QQLHQPTPVQHPPPLPSPALS-VSSSIPPSPATSYAESTTSSITDLARLEKMKVSDLKQHLKRRN 887
                  |||:     |:..|| ..:.|.|                 |.||:|||::||..||.|.
Zfish   384 ------TPVR-----PNSTLSNRKAGILP-----------------ANLEEMKVAELKMELKLRG 420

  Fly   888 LPVSGPKPHLIERLKPYLPLEPLDSNVTPAPTSNNSNTTPEVITISDAMDTSN-----------C 941
            |||||.|..|||||||:     .::.:|.||  |||:|.|:.......|:.|:           .
Zfish   421 LPVSGTKTDLIERLKPF-----QENPITTAP--NNSSTGPKTQPCGTPMEVSSTTTTISPIQLPS 478

  Fly   942 GLLEQPPPVTMLVSDASMEHEQMDVVQQQMDNTHPMTLQTILPPQPQTATIILTNEELLREQQRK 1006
            ..|...|||:...|:. :..|.|. |:.|.:..:...::....|:.|        :..|.|::|:
Zfish   479 NTLSSTPPVSPSSSEL-LSREDMS-VEGQAETQNRCLIKANAVPEEQ--------DRRLHEKERQ 533

  Fly  1007 IDELQRQLQRSQQELQKIRQRQQQQQHQQQQTVTAQVVNALPSQQITLITTTSNGPQQTLTVMPQ 1071
            |:||.|:|::.|:.:::::                                           |..
Zfish   534 IEELLRKLEQEQKLVEELK-------------------------------------------MQL 555

  Fly  1072 QVEKNFPAKVTVKATGGNSNHKVNGLQQQGSAAKKPASSNSNSNSNISSSNPPPINQKMVVKQQL 1136
            :|||......:|:      |:.|:|              .|...:::.:.|..|.|         
Zfish   556 EVEKRSGVVPSVE------NNNVSG--------------PSIMLASVKAENTVPPN--------- 591

  Fly  1137 EAKIQKQKAAAAAAAQQQQQQQQQQQQQQQQQALQQQQQQQQQQQQVRLLTQK--TQTVF-IPFN 1198
             .|:...........::....|......:|.....|...|...|.|..|.||.  ||.:. :|..
Zfish   592 -CKLNSHTTTTLVKLEEAHPNQVTTAPLRQFIISHQGVPQVIGQPQTLLTTQHGGTQILLPMPLA 655

  Fly  1199 NNN---HINNASAKTTTKKSNVPANNTNTTTATMMQAAKPAAVAAAAASPGNQH---HNNLGLLW 1257
            ||.   .:.||:.|.......|....|.......:|:.|       |.||.:|.   ||::    
Zfish   656 NNTTTIQLPNANVKLQPVLQAVSTPGTGLIQTPQLQSTK-------AESPTSQQLLSHNHI---- 709

  Fly  1258 NEGNQTILLLGLND----QHMTAHTLGNISL----TATTTTTAAPPAATPVAASTIAPPKKILNG 1314
               .|| |.:|..:    ||.|:.....:.:    .:::......|..:|:       |..::||
Zfish   710 ---VQT-LSVGTTERSGFQHSTSENQAGLEIPQCFLSSSPENRTSPQTSPI-------PSSLING 763

  Fly  1315 HQRTNSLPSIVFPIETKSIITQQQLQQLQQQQQQQQQFQPV--QQPKQQQLNQVDIKPAPAPPPQ 1377
                                      ||.:....||  .||  |.||.::            ||:
Zfish   764 --------------------------QLNKASFIQQ--CPVFNQAPKNRE------------PPR 788

  Fly  1378 YEEATKQLAASKAAALNGLLPLVKIKEEPVQSPAPSAAPLPQTAPLCKRKTASIKSEQVSDVLDI 1442
            ||||.||..:                   :|:|..|..|             ::.|:|:.|:.||
Zfish   789 YEEAVKQTRS-------------------LQNPTISEFP-------------TVTSQQMDDLFDI 821

  Fly  1443 LIKQGELPESAALEPITPLTPLPELSMFNGATPTTAAGGASIVPLVPKLETPVTPVQNLDVAMDT 1507
            ||:.||:...:..:|..|           ...|.||:  .:.:|:...|..|...||        
Zfish   822 LIESGEITPFSQQDPSVP-----------KMMPVTAS--ITTLPISTALSRPPAQVQ-------- 865

  Fly  1508 NVQHVGFASNQAPNHVFIESIDMASPLQTDS--SAI-------DAESVAKTLDIFLE-QHHATPP 1562
                     ...|..:.:|::...:.|.:|:  .|:       |.|...:||.:..| |:.....
Zfish   866 ---------MAPPPTLMVEALPSLASLDSDNQLEALLEGTLVGDTEPEQRTLCLLEELQNQMLDQ 921

  Fly  1563 PSTPPKSCHSG-SEKPNSPDAKLNH--FDEYELLEL 1595
            |::|..:...| |:.|......|..  .|..|.|:|
Zfish   922 PNSPMDTSELGFSDPPTQSSFSLQDTGLDNMEWLDL 957

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MrtfNP_001137879.3 RPEL 387..412 CDD:128947 13/25 (52%)
RPEL 433..458 CDD:128947 14/25 (56%)
SAP 871..905 CDD:280251 23/34 (68%)
mrtfbaXP_009304978.1 RPEL 46..70 CDD:128947 13/24 (54%)
RPEL 91..112 CDD:280851 12/21 (57%)
RPEL 133..158 CDD:128947 14/25 (56%)
SAP 404..437 CDD:280251 23/33 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C38952456
eggNOG 1 0.900 E1_28MIF
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 194 1.000 Inparanoid score I3749
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001625
OrthoInspector 1 1.000 T596052
orthoMCL 1 0.900 OOG5_131229
Panther 1 1.100 O PTHR22793
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4963
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.