DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mrtf and Mrtfa

Sequence 1:NP_001137879.3 Gene:Mrtf FlyBaseID:FBgn0052296 Length:1788 Species:Drosophila melanogaster
Sequence 2:XP_006226225.1 Gene:Mrtfa RGDID:1304873 Length:1038 Species:Rattus norvegicus

Alignment Length:1382 Identity:324/1383 (23%)
Similarity:480/1383 (35%) Gaps:574/1383 (42%)


  Fly   332 SPLQPAMDKNKESLKVKLMVRRPHSQLVEQGIIPSLKTSPAIHEQCKQLERAKTSDLLKAKIQQR 396
            :|..|.:.:.|..|::||..||...:||.|||:|.||:..|.|||.:.||||:|.|.||.||:.|
  Rat    79 NPNLPPLSERKNVLQLKLQQRRTREELVSQGIMPPLKSPAAFHEQRRSLERARTEDYLKRKIRSR 143

  Fly   397 PNREDLERLHILEEDECHIDPSLAEKQRMLKKARLADQLNSQIQHRPGPLELIKKNILHTEKPIE 461
            |.|.:|.|:|||||...  :|||..||..||:|||||.||.:|..||||:||::||||    |:|
  Rat   144 PERSELVRMHILEETSA--EPSLQAKQLKLKRARLADDLNEKIAQRPGPMELVEKNIL----PVE 202

  Fly   462 KIVKEGLV-------------SFKATSEGLLTRPQHPHSYVTFDDDSLSSESDTRQTPPRLDEAM 513
            ..:||.|:             ||...|...|: |:.|.|:.:  ..|:.|..::|.:    |...
  Rat   203 SSLKEALIVGQVNYPKVADSSSFDEDSSDALS-PEQPASHES--QGSVPSPLESRAS----DLLP 260

  Fly   514 VATSSSPTDVLQAAAASAGIVTMALTMPTAGQLVVTSPQILPQQQQPKAIVVPAPVPPPPPPPPP 578
            .|||.|||.||..       :.||   |..|:.:..:       :||       |:||||..||.
  Rat   261 SATSISPTQVLSQ-------LPMA---PDPGETLFLA-------EQP-------PLPPPPLLPPS 301

  Fly   579 LPMASIIKVKQETANLYEELCQSVTGTTASPVNHLYSPCSLASSTSTLSPLSSIASPPPPPMTTT 643
            |...||:                   .||.|                                  
  Rat   302 LTSGSIV-------------------PTAKP---------------------------------- 313

  Fly   644 RLHLAPVSVKSDAP--GKDKNRKKSKSKPVS-KARTIKFHEYKGPPSAAGQKQDQTQPE-ETSYQ 704
                ||..:|...|  ..:|:::..|:|.:. |.:.:|:|:|. ||.   ||||:..|. ::||.
  Rat   314 ----APTLIKQSQPKSASEKSQRSKKAKELKPKVKKLKYHQYI-PPD---QKQDKGAPAMDSSYA 370

  Fly   705 LMLEQQNCLLKFLENLNKN-----------QSIIPAPSAPGVMLPAAPGATNNSITVTTKTVPAL 758
            .:|:||...|: |:.||:.           |:|:|||..|.       |.|..|           
  Rat   371 KILQQQQLFLQ-LQILNQQQQQQQQQHYNYQAILPAPPKPS-------GETPGS----------- 416

  Fly   759 ASQSAPAPAPISLPNTISITSSSGGAPLNFGDATMLTPTPAATPTPPTLSLIAAPQQQLQLHQQH 823
               |||.|:     .::|.:|||...          ||.|.......:.:|...|          
  Rat   417 ---SAPTPS-----RSLSTSSSSSSG----------TPGPGGLARQNSTALAGKP---------- 453

  Fly   824 QQLHQPTPVQHPPPLPSPALSVSSSIPPSPATSYAESTTSSITDLARLEKMKVSDLKQHLKRRNL 888
                                   .::|                  |.|:.|||::|||.||.|:|
  Rat   454 -----------------------GALP------------------ANLDDMKVAELKQELKLRSL 477

  Fly   889 PVSGPKPHLIERLKPYLPLEPLDSNVTPAPTSNNSNTTPEVITISD------------------- 934
            ||||.|..|||||:.|      ...|:|||.:..:..|..|::.:.                   
  Rat   478 PVSGTKTELIERLRAY------QDQVSPAPGAPKAPATTSVLSKAGEVVVAFPAALLSTGSALVT 536

  Fly   935 ----------AMDTSNCGLLE-----QPPPVTMLVSDASM------EHEQMDVVQQQMDNTHPMT 978
                      |..||| |:::     ..|||:...|:.|:      .....|...:.:  |.|:|
  Rat   537 AGLAPAEMVVATVTSN-GMVKFGSTGSTPPVSPTPSERSLLSTGDENSTPGDAFGEMV--TSPLT 598

  Fly   979 LQTI-------------------LPPQPQTATIILTNEELLREQQRKIDELQRQLQRSQQELQKI 1024
            ..|:                   |.|..:.....|..:::|:|:.::|:||.|.||:.||.::.:
  Rat   599 QLTLQASPLQIVKEEGARAASCCLSPGARAELEGLDKDQMLQEKDKQIEELTRMLQQKQQLVELL 663

  Fly  1025 RQRQQQQQHQQQQTVTAQVVNALPSQQITLITTTSNGPQQTLTVMPQQVEKNFPAKVTVKATGGN 1089
            |.:.:||:..||           |:...:.:...|:.....|:..||...:.|...:.|..|   
  Rat   664 RLQLEQQKRAQQ-----------PAPASSPVKRESSFSSCQLSCQPQGAARAFGPGLVVPTT--- 714

  Fly  1090 SNHKVNGLQQQGSAAKKPASSNSNSNSNISSSNPPPINQKMVVKQQLEAKIQKQKAAAAAAAQQQ 1154
             ||         ..|:.||..:            ||:    ||||  ||...:...|.|:     
  Rat   715 -NH---------GDAQAPAPES------------PPV----VVKQ--EAGPPEPDLAPAS----- 746

  Fly  1155 QQQQQQQQQQQQQQALQQQQQQQQQQQQVRLLTQKTQTVFIPFNNNNHINNASAKTTTKKSNVPA 1219
                                         :||.....|.|:                 ||.:.|.
  Rat   747 -----------------------------QLLLGSQGTSFL-----------------KKVSPPT 765

  Fly  1220 NNTNTTTATMMQAAKPAAVAAAAASPGNQHHNNLGLLWNEGNQTILLLGLNDQHMTAHTLGNISL 1284
            ..|::|                                  |...|                   |
  Rat   766 LVTDST----------------------------------GTHLI-------------------L 777

  Fly  1285 TATTTTTAAP--PAATPVAASTIAPPKKILNGHQRTNSLPSIVFPIETKSIITQQQLQQLQQQQQ 1347
            |.|..:...|  |..:|.                                               
  Rat   778 TVTNKSADGPGLPTGSPQ----------------------------------------------- 795

  Fly  1348 QQQQFQPVQQPKQQQLNQVDIKPAPAPPPQYE-EATKQLAASKAAALNGLLPLVKIKEEP----- 1406
                 ||:.||.         .|||.||.|.: |...|.:.:...:|        :|:||     
  Rat   796 -----QPLSQPG---------SPAPGPPAQMDLEHPPQPSFATPTSL--------LKKEPPGYEE 838

  Fly  1407 --VQSPAPSAAPLPQTAPLCKRKTASIKSEQVSDVLDILIKQGEL----------------PESA 1453
              .|.|              |::.....|:.:.|:.||||:.||:                |.:.
  Rat   839 TVTQQP--------------KQQENGSSSQHMDDLFDILIQSGEISADFKEPPSLPGKEKSPPAE 889

  Fly  1454 ALEPITPLTPLPE-LSMFNGATPTTAAGGASIVPLVP-KLETPVTPVQNLDVAMDTNVQHVGFAS 1516
            |..|  ||||.|. ||....|.|...:      |.:| :||..:.....|.:..         :.
  Rat   890 AYGP--PLTPQPSPLSELPQAAPPPGS------PTLPGRLEDFLESSTGLPLLT---------SG 937

  Fly  1517 NQAPNHVFIESIDMASPLQTDSSAID-AESVAKTLDIFLEQHHATPPPSTPPKSCHSGSEKPNSP 1580
            ::.|..:.:.. |:.|.:.:.|:.:| ..|...|.::     |..|.||       ||.    ..
  Rat   938 HEGPEPLSLID-DLHSQMLSSSAILDHPPSPMDTSEL-----HFAPEPS-------SGM----GL 985

  Fly  1581 DAKLNHFDEYELLELMS 1597
            |..:.|.|..:.|||.|
  Rat   986 DLAVGHLDSMDWLELSS 1002

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MrtfNP_001137879.3 RPEL 387..412 CDD:128947 15/25 (60%)
RPEL 433..458 CDD:128947 14/25 (56%)
SAP 871..905 CDD:280251 22/34 (65%)
MrtfaXP_006226225.1 RPEL 91..115 CDD:128947 12/24 (50%)
RPEL 134..159 CDD:128947 15/25 (60%)
RPEL 178..203 CDD:128947 16/29 (55%)
SAP 460..493 CDD:280251 21/33 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C38938080
eggNOG 1 0.900 E1_28MIF
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 212 1.000 Inparanoid score I3515
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001625
OrthoInspector 1 1.000 T617473
orthoMCL 1 0.900 OOG5_131229
Panther 1 1.100 LDO PTHR22793
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
98.840

Return to query results.
Submit another query.