DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mrtf and Myocd

Sequence 1:NP_001137879.3 Gene:Mrtf FlyBaseID:FBgn0052296 Length:1788 Species:Drosophila melanogaster
Sequence 2:XP_006246644.1 Gene:Myocd RGDID:631347 Length:986 Species:Rattus norvegicus

Alignment Length:1330 Identity:278/1331 (21%)
Similarity:445/1331 (33%) Gaps:497/1331 (37%)


  Fly   340 KNKESLKVKLMVRRPHSQLVEQGIIPSLKTSPAIHEQCKQLERAKTSDLLKAKIQQRPNREDLER 404
            |.:..|:::|..||...||..||:||.||:....|:..|:|:.|||.|.|:.|::.|.:|..|..
  Rat    15 KFRSVLQLRLQQRRTQEQLANQGLIPPLKSPTEFHDPRKKLDSAKTEDSLRRKVRNRSDRASLVN 79

  Fly   405 LHILEEDECHIDPSLAEKQRMLKKARLADQLNSQIQHRPGPLELIKKNILHTEKPIEKIVKEGLV 469
            :|||:....  :.|:...|..||:|||||.||.:|..|||||||::||||..:..:::.:|...|
  Rat    80 MHILQASTA--ERSIPTAQMKLKRARLADDLNEKIALRPGPLELVEKNILPMDSSVKEAIKGTEV 142

  Fly   470 SFKATSEGLLTRPQHPHSYVTFDDDSLS---SESDTRQTPPRLDEAMVATSSSPTDVLQAAAASA 531
            |....::..           .|:|||..   |....|...|:      .:..|..|:....|   
  Rat   143 SLSKAADAF-----------AFEDDSSRDGLSPDQARSEDPQ------GSGGSTPDIKSTEA--- 187

  Fly   532 GIVTMALTMPTAGQLVVTSPQILPQQQQPKAIVVPAPVPPPPPPPPPLPMASIIKVKQETANLYE 596
                     |.||.|                                                  
  Rat   188 ---------PLAGPL-------------------------------------------------- 193

  Fly   597 ELCQSVTGTTASPVNHLYSPCSLASST--STLSPLSSIASPPPPPMTTTRLHLAPVSVKSDAPGK 659
            :..|.:|..:.|..|...|..|..|.:  ..|.|||:     |.|:.|        :|||.:.|.
  Rat   194 DTIQDLTPGSESDKNDTASQLSNQSDSGKQVLGPLST-----PIPVHT--------AVKSKSLGD 245

  Fly   660 DKNRKKSKSKPVSKARTIKFHEYKGPPSAAGQKQDQTQPEETSYQLMLEQQNCLLKFLENLNKNQ 724
            .|||.|....|..|.:.:|:|:|. ||....:|  ...|.:::|..:|:||...|: |:.|::.|
  Rat   246 SKNRHKKPKDPKPKVKKLKYHQYI-PPDQKAEK--SPPPMDSAYARLLQQQQLFLQ-LQILSQQQ 306

  Fly   725 SIIPAPSAPGVMLPAAPGATNNSITVTTKTVPALASQSAPAPAPISLPNTISITSSSGGAPLNFG 789
            .                                                                
  Rat   307 Q---------------------------------------------------------------- 307

  Fly   790 DATMLTPTPAATPTPPTLSLIAAPQQQLQLHQQHQQLHQPTPVQHPPPLPSPALSV-----SSSI 849
                                 ...|||.|..||.||.....|..|...|..|...:     |||.
  Rat   308 ---------------------QQQQQQQQQQQQQQQQRFSYPGMHQAHLKEPNEQMTRNPNSSST 351

  Fly   850 P----PSPATSYAESTTSSITDL------ARLEKMKVSDLKQHLKRRNLPVSGPKPHLIERLKPY 904
            |    |......:.|..:.::.|      ..|:.:|||:|:|.|:.|.|||||.|..|::||:|:
  Rat   352 PLNNTPLSPVKNSLSGQTGVSSLKPGPLPPNLDDLKVSELRQQLRIRGLPVSGTKTALVDRLRPF 416

  Fly   905 LPLEPLDSNVTPAPTSNNSNT-----TPEVITISDAMDTS--NCGLLEQPPPVTMLVSDASMEHE 962
                 .|....|.|...:..|     ||..:....:..:.  :.|.....||::...||.|....
  Rat   417 -----QDCAGNPVPNFGDITTVTFPVTPNTLPSYQSSPSGFYHFGSTSSSPPISPASSDLSAAGS 476

  Fly   963 QMDVVQQQMD----NTHPM---TLQTIL--------PPQPQTATIILTNEELLREQQRKIDELQR 1012
            ..|.......    :..|:   |.:::|        |.:|.  .:....:::|.|:|:.|::|..
  Rat   477 LPDTFTDASPGFGLHASPVPACTDESLLSSLNGGSGPSEPD--GLDSEKDKMLVEKQKVINQLTW 539

  Fly  1013 QLQRSQQELQKIRQRQQQQQHQQQQTVTAQVVNALPSQQITLITTTSNGPQQTLTVMPQQVEKNF 1077
            :|::.|::::::|.:.|:|:.           .....:.:..:.||..  |:.::..|      |
  Rat   540 KLRQEQRQVEELRMQLQKQKS-----------GCNDQKPLPFLATTIK--QEDVSSCP------F 585

  Fly  1078 PAKVTVKATGGNSNHKVNGLQQQGSAAKKPASSNSNSNSNISSSNPPPINQKMVVKQQLEAKIQK 1142
            .|:   :|:|....|                          ||.:|||                 
  Rat   586 AAQ---QASGKGQGH--------------------------SSDSPPP----------------- 604

  Fly  1143 QKAAAAAAAQQQQQQQQQQQQQQQQQALQQQQQQQQQQQQVRLLTQKTQTVFIPFNNNNHINNAS 1207
                |...||......:...|.....:.....|...|...:..| :..|.:.:|.:.|||...||
  Rat   605 ----ACETAQLLPHCVESSGQTHVLSSTFLSPQCSPQHSPLGTL-KSPQHISLPPSPNNHYFLAS 664

  Fly  1208 AKTTTKKSNVPANNTNTTTATMMQAAKPAAVAAAAASPGNQHHNNLGLLWNEGNQTILLLGLNDQ 1272
            :....::::                        ..:||    :::.|...|.|            
  Rat   665 SSGAQRENH------------------------GVSSP----NSSQGCAQNSG------------ 689

  Fly  1273 HMTAHTLGNISLTATTTTTAAPPAATPVAASTIAPPKKILNGHQRTNSLPSIVFPIETKSIITQQ 1337
               ||             ...||:.:|.::|...|    .:|.|..:|..|.:.|. .||.:...
  Rat   690 ---AH-------------EGHPPSFSPPSSSLHQP----FSGTQADSSHSSGLNPC-PKSPVIHP 733

  Fly  1338 QLQQLQQQQQQQQQFQ------PVQQPKQQQLNQVDIKPAPAPPPQYEEATKQLAASKAAALNGL 1396
            ::..||...:....|.      |...|...::.|         ||.||:|.||            
  Rat   734 KMTGLQSSDKVGPTFSIPSPTFPKSSPTVPEITQ---------PPSYEDAVKQ------------ 777

  Fly  1397 LPLVKIKEEPVQSPAPSAAPLPQTAPLCKRKTASIKSEQVSDVLDILIKQGELPESA-----ALE 1456
                                            ...:|:|:.::||:||:.||:|..|     .|:
  Rat   778 --------------------------------QMTRSQQMDELLDVLIESGEMPADAREDHSCLQ 810

  Fly  1457 PI--------TPLTPLPELSMFNGATPTTAAGGASI------------VPLVPKLETPVTPVQNL 1501
            .|        :|.|.||:.|    |:...|:.|..|            :.::....:|:..|.::
  Rat   811 KIPKIPGSSCSPTTILPKSS----ASFEQASSGGQISFDHYATDSEEHLEVLLNSHSPIGKVSDV 871

  Fly  1502 ------------DVAMDTNVQHVGFASNQA---------------PNHVFIESIDMASPLQTDSS 1539
                        |..||      ||....|               |.|.      ..||...|||
  Rat   872 TLLKIGSEEPPFDGIMD------GFPGKAAEDLFSAHELLPGPLSPMHT------QLSPPSVDSS 924

  Fly  1540 AID---AESVAKTLDIFLEQHHATPPPSTP 1566
            .:.   .||..:|:: :|:   .|||.|||
  Rat   925 GLQLSFTESPWETME-WLD---LTPPSSTP 950

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MrtfNP_001137879.3 RPEL 387..412 CDD:128947 9/25 (36%)
RPEL 433..458 CDD:128947 15/25 (60%)
SAP 871..905 CDD:280251 18/34 (53%)
MyocdXP_006246644.1 RPEL 106..131 CDD:128947 15/25 (60%)
SAP 383..416 CDD:280251 18/33 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C38951648
eggNOG 1 0.900 E1_28MIF
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 212 1.000 Inparanoid score I3515
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T617473
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22793
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
76.940

Return to query results.
Submit another query.