DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fife and CG15803

Sequence 1:NP_001261340.1 Gene:Fife FlyBaseID:FBgn0264606 Length:1314 Species:Drosophila melanogaster
Sequence 2:NP_001287388.1 Gene:CG15803 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster

Alignment Length:855 Identity:166/856 (19%)
Similarity:264/856 (31%) Gaps:339/856 (40%)


  Fly   508 GFGMRVVGGK-TGADGRLFAYIVWTVPGGAAEKNG-LQQGDKILEWNGMSLIDRSFEEVCSIMDR 570
            |.|..:|||: ||      ..|....|||.||::| ||.||.:|:...::|...|.|:|.:::.:
  Fly    21 GLGFILVGGRSTG------VVIKALTPGGVAERDGRLQLGDHLLQIGEVNLRGFSSEQVATVLRQ 79

  Fly   571 TGDVVELLVEHATDFRMCDLFDENLPPGNAGGQSGPRRSGDGPVGLGLIAEPETTTDKSPASPTR 635
            ||..|.|:|....:                            |..:    :.:|...::|..|| 
  Fly    80 TGAQVRLIVARPVE----------------------------PTAI----DYQTLACQAPIIPT- 111

  Fly   636 RKLPKTPEQIAREKL-----------------------------------VTGRVQIQVWYHAER 665
             ||...||:::|...                                   |...|.:.....||.
  Fly   112 -KLLSDPEELSRHLFQNPSFATAAVAAAAAAAAAAGSGSDGDVGGGGVLDVASLVGLVRGGPAEG 175

  Fly   666 SEL---------------VVSLMAGD----DLAPRDEAYGHGNLPEAYAKVRILPKCGDGSVQQT 711
            :||               .:|.:|||    .|.|.....||..:.::.|..|..|:. |..:...
  Fly   176 TELSAVEPQPSAAVLQLQQLSELAGDLADFPLPPIPGGGGHSMVTDSNAGQRPCPRL-DLDIVPF 239

  Fly   712 EVSRPTQNPIWNATLTFGHVKADTLMVRYIDIQLWDLVP----HTESIFLGECSIELQQAFLDDQ 772
            .:..|...|              .|.:..::.| |..|.    |.|::                 
  Fly   240 SILSPPPRP--------------ALQMLPLETQ-WRCVQDQNRHIETV----------------- 272

  Fly   773 AIWCRLEDTKGLRGISISKSPSVSPRGSI-AAGAGAPSGDVTRLLRRDYNMQRSNSDDVDSIGDG 836
                 :.|:|       .|..:....||. |:|:|:|                      ||..| 
  Fly   273 -----IADSK-------RKLLANEDGGSASASGSGSP----------------------DSYMD- 302

  Fly   837 TSLLHPDHAWIAGSRRGSSQSETMEVE----VYQLG----------KDFSRSLPGS--RRSSFQD 885
                             |.::||..||    ||.||          :|.|.....|  ..|:.:.
  Fly   303 -----------------SPETETYVVELHKNVYGLGITVAGYVCEEEDLSGIFVKSIIEGSAAET 350

  Fly   886 AEKNRLEEDAMATPPTSYLVGRRRSSVARRDPDEILKSLK-AVRGELGRTMSLGTEQHKRMGSRR 949
            :.:.::.:..:|..      ||..|.|......|:|::.. .|...|.|.:.....:|.::....
  Fly   351 SGQIQINDRIVAVD------GRSLSGVTNHQAVELLRNTDIVVHLTLERFLRGRKYEHLQVALTE 409

  Fly   950 ASRVGLPSGPSSRKSSVLDLSQQHQQQLQQLQQLQLQQQQYLQ--QQLPMGVGNADTSPPSEDE- 1011
            ......|||        ||.||...|  .|..||.:.....:.  ..||....:||:.....|| 
  Fly   410 IKGTSAPSG--------LDRSQDKDQ--DQESQLSMPGSPSIATLSWLPPKSLDADSIATEGDEA 464

  Fly  1012 -DKRY----------------------------RPRWKGSVS--QLPPQSPKQALSRLKQAASAS 1045
             |..|                            |....|.::  |:|..||...|:..:....|.
  Fly   465 VDAEYVGISGAEDEFIELPSRDTVESNMSHVLDRSDHSGGLTKDQVPRISPIVPLTNGRSLILAD 529

  Fly  1046 NVAQDTQRQGQLLTTNPLQQRKSS------MFQLGES------------------------QASP 1080
            :...||..|.....|...|.||.|      :..||::                        :|:.
  Fly   530 DSGNDTDEQCAEPETETAQARKGSKPETERVKDLGDTKTDTDPDPDLDPGQMPTPTNEAPVKAAS 594

  Fly  1081 PTTTTTHLQRK-------GSMYVAKVTETPPHGTPTRKGSVYQRSVVGLSVDSPGADSPQRKQSV 1138
            ||..:..:..|       |::.|....|..||.        |.||::        ||.|..:|.:
  Fly   595 PTAASLRVAWKSLGISLEGTVDVECGIEKRPHH--------YIRSIL--------ADGPVGRQGI 643

  Fly  1139 VKTLSGSYVNICPLTGGESSYGLKLGPSQIHPKGYRLTTARYGELKMGFLKIKGNV--EVELICA 1201
                                  |:.|...:....::|...|:.|:    :||...:  .|:|:||
  Fly   644 ----------------------LRPGDELLQVNEHKLQGLRHIEV----VKILKELPARVKLVCA 682

  Fly  1202 R-----NIVN 1206
            |     :::|
  Fly   683 RGTHVPSVIN 692

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FifeNP_001261340.1 FYVE_BSN_PCLO 130..187 CDD:277290
PDZ_signaling 491..580 CDD:238492 28/74 (38%)
DegQ <526..577 CDD:223343 19/52 (37%)
C2A_RIM1alpha 651..779 CDD:175997 26/151 (17%)
C2 1163..1304 CDD:301316 12/52 (23%)
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492 28/74 (38%)
PDZ 307..393 CDD:214570 21/92 (23%)
PDZ_signaling 605..680 CDD:238492 22/117 (19%)
PDZ 773..858 CDD:214570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.